SecReT6
Protein ID: 375145911
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2608
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3236703..3237572 [-]
Producthypothetical protein
NoteTssN
UniProt IDG8TR34
KEGG IDnko:Niako_2608
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 289 a.a.     [Download]
>gi|375145911|ref|YP_005008352.1| hypothetical protein [Niastella koreensis GR20-10]
MLSPELNRLLLYLGISLVSFSAIIGIFAKKIRNSFKPFSKRAIWYLLISVAVFALTGLFIAAGFFSNYNR
YFIFFQILFLLYGGLHIYMMQRKMDWGKDKQSFWPDLIFTVLIALAGAICFMLTYRWVNREGLEIPMMWS
TIFFIIPLFVWHTFLTALAIPPKVLNQWYYPVHDPMEDPEESKLKNMLLISFEFQKNGQDSFFTNFRAKA
PVDMELGELFYYFINDYNERHPQGQILYSSGVGKPHGWMFYKKPKWYTILTTYMDADKTIFLNRIRENDV
IVCSRIIEN
 
Nucleotide Sequence: 870 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3237572-3236703 Niastella koreensis GR20-10 chromosome, complete genome
ATGCTTTCACCTGAACTTAACAGATTGTTATTGTACCTGGGAATAAGCCTGGTGAGCTTTTCAGCGATCA
TAGGCATATTCGCCAAAAAAATACGTAACAGTTTTAAACCATTCAGCAAAAGGGCTATCTGGTATCTGTT
GATTTCTGTGGCGGTATTTGCATTGACCGGTCTATTCATTGCAGCCGGCTTTTTTTCTAACTACAACAGG
TACTTTATTTTCTTCCAGATTTTATTCCTGCTATATGGCGGTTTGCATATTTATATGATGCAACGAAAAA
TGGATTGGGGTAAAGACAAGCAATCTTTCTGGCCCGATCTTATTTTCACGGTATTGATCGCGTTGGCCGG
CGCCATTTGTTTTATGCTTACGTACCGCTGGGTAAACCGGGAGGGGTTGGAAATACCAATGATGTGGTCG
ACCATATTTTTTATTATTCCCCTGTTTGTATGGCACACCTTCCTGACCGCCCTGGCCATTCCGCCCAAAG
TATTGAACCAATGGTATTACCCGGTGCATGACCCCATGGAAGATCCCGAAGAAAGCAAGCTGAAAAATAT
GTTGCTCATCAGCTTTGAATTTCAAAAGAACGGGCAGGATTCGTTCTTCACCAACTTCAGGGCCAAAGCG
CCTGTAGATATGGAACTGGGTGAACTGTTCTATTATTTCATCAACGATTACAATGAGCGGCATCCGCAGG
GACAGATACTTTATTCAAGCGGTGTAGGCAAACCACATGGCTGGATGTTTTACAAAAAACCAAAATGGTA
TACCATACTAACCACCTACATGGATGCAGATAAAACCATTTTCCTGAATCGCATCAGGGAAAATGATGTA
ATAGTGTGCAGCCGTATAATTGAAAACTAA