SecReT6
Protein ID: 375145912
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2609
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3237634..3238569 [-]
Producthypothetical protein
NoteTssG
UniProt IDG8TR35
KEGG IDnko:Niako_2609
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 311 a.a.     [Download]
>gi|375145912|ref|YP_005008353.1| hypothetical protein [Niastella koreensis GR20-10]
MTRHEAIEQFFNELLGNLHDIKAEVMANHALQNNVHPDDFVVLHDGRFFREYRTDVYAINKIDDAWRHQL
LQLRLSRSGLYDLVPEGLFHQSYTGTKSNAATELAAQSRIDRKKELAARKFFQPVENSLFRQRVLMEQEE
ENLLAGMDNGLLNDYFFTFWEFPEALNKTSAMLLVLLLPYAHAIAGDIELMQKCLEILLQEDVTIEQVTP
ANCVAPGKDNSLGMGELGNDFVCGQTFMEDYPCLQYNIGLLQQSKPADYVSGGDNDLLLQVFNNYFAPAE
ADIIINVEVDRARVLVELSADESPILGFAAI
 
Nucleotide Sequence: 936 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3238569-3237634 Niastella koreensis GR20-10 chromosome, complete genome
ATGACAAGACACGAAGCCATAGAACAATTCTTTAACGAGCTGTTGGGCAACCTGCACGATATAAAAGCGG
AGGTGATGGCCAATCACGCATTGCAAAACAATGTGCACCCCGATGATTTTGTTGTGTTGCACGACGGCCG
TTTTTTCCGGGAATACCGGACGGATGTGTATGCGATAAATAAGATCGACGATGCCTGGCGGCACCAGTTA
TTGCAACTGCGGTTATCACGATCCGGTTTATACGACCTGGTGCCCGAGGGGCTTTTTCACCAGTCGTATA
CCGGCACCAAATCAAATGCAGCTACCGAGCTGGCAGCGCAAAGCCGGATAGACCGCAAAAAAGAACTGGC
TGCCCGGAAGTTCTTTCAACCTGTTGAAAACAGTTTGTTCAGACAACGGGTGCTGATGGAACAGGAAGAA
GAAAACCTGCTGGCCGGGATGGACAATGGCCTGCTGAACGATTATTTTTTCACCTTCTGGGAGTTTCCCG
AAGCGCTGAACAAAACTTCGGCCATGCTGCTGGTACTGCTGTTACCCTATGCACATGCCATTGCCGGTGA
TATTGAATTAATGCAAAAATGCCTGGAGATATTGTTACAGGAAGATGTAACCATCGAGCAGGTAACACCG
GCCAATTGTGTGGCGCCCGGTAAAGACAACAGCCTGGGCATGGGCGAACTGGGTAATGATTTTGTATGCG
GGCAAACTTTTATGGAAGATTATCCCTGTTTACAGTACAACATTGGCCTCTTGCAGCAATCGAAACCGGC
TGATTATGTAAGCGGCGGCGACAATGACCTGTTATTACAGGTGTTCAATAATTATTTCGCACCGGCGGAA
GCCGATATCATTATAAATGTAGAAGTTGATCGTGCCCGTGTTTTGGTTGAACTGAGCGCAGATGAATCCC
CGATATTAGGGTTCGCTGCCATTTAG