SecReT6
Protein ID: 375145913
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2610
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3238707..3240575 [-]
Producthypothetical protein
NoteTssF
UniProt IDG8TR36
KEGG IDnko:Niako_2610
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 622 a.a.     [Download]
>gi|375145913|ref|YP_005008354.1| hypothetical protein [Niastella koreensis GR20-10]
MENREQIKNRMMKTAARLWGYPEDETESSFDPLVNVLFSATALELEKLSNEIHASRARLLERMVQLLSPE
VLCGPLPAHGILSARSIDETSWLKADDQFYTSQKRGGNYEDQSGASGYRDFYFTPTGNFQLNTATVSYLA
TGHQLFRYREMVSKEVITHCLPGKELEQRVLWIGLTGSRIKLHNTQYYFELRNEVNKELFYKNLADARWF
YGDEEMEVVPGYNQDNISGEHLDIEQLLIRKNTASWKLKEFVNAYYKPRFITIRHRDKTVGEPGGWPMAL
QQVFDKKELQSLQADNVHWIKIQFPENIATSVLQDVVCHINCFPVINGRLHETLHHMHDILNIVPLYIND
TFFDLHEITDQDNHIYNIRALEKNAREKLTVILRQGGVGRFDERDATMIIENIVQLLSDESAAFSVLGRD
FLSGELKQLQTIIYKLEQQMITRELNREYTPFLVVRKDDKAKLNNLTISYWSTAAEQGNDIKAGTTLQSY
KTSSLYQGNCTLITTTIGGRNRLSASESITAYKSALLSRDRLISLEDIKIFCRLQLGNTAKHIEVKKGVM
VPRQVSQGFIRTIDVTIKLSRKDFMDAQEKNQLQYWKESLVLKLASKSAGLTPFRVFIEQEN
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3240575-3238707 Niastella koreensis GR20-10 chromosome, complete genome
ATGGAAAATCGGGAACAAATAAAGAACCGGATGATGAAAACGGCTGCGCGCCTGTGGGGCTATCCGGAAG
ATGAAACCGAATCGTCTTTCGACCCGCTGGTGAATGTGCTGTTCTCCGCCACTGCATTGGAACTGGAAAA
GCTCTCCAACGAGATCCATGCTTCGCGAGCCCGTTTGCTGGAACGGATGGTGCAGCTATTGTCGCCTGAA
GTATTGTGTGGTCCCTTACCGGCGCATGGGATTTTAAGTGCGCGTTCAATTGATGAAACAAGCTGGCTCA
AAGCAGACGATCAGTTTTATACCTCACAAAAAAGAGGAGGGAACTATGAAGATCAATCAGGCGCCAGCGG
CTACAGAGATTTCTATTTTACGCCAACCGGCAACTTTCAATTAAATACCGCCACCGTTTCTTATCTCGCT
ACCGGTCATCAATTGTTCCGGTACCGGGAAATGGTGTCCAAAGAAGTGATCACGCATTGTTTACCGGGCA
AAGAACTGGAGCAACGGGTACTTTGGATCGGGCTTACCGGTAGCCGCATTAAGCTGCATAACACCCAATA
TTATTTTGAGCTCAGGAATGAAGTAAATAAAGAACTGTTCTATAAAAACCTGGCCGACGCCCGCTGGTTT
TATGGCGATGAAGAAATGGAAGTTGTGCCCGGTTATAACCAGGACAATATCAGCGGTGAGCACCTGGACA
TTGAGCAGTTGTTGATAAGAAAGAATACCGCCTCCTGGAAATTAAAGGAGTTTGTAAATGCCTATTACAA
ACCCAGGTTCATTACTATCCGCCATCGCGATAAAACAGTTGGGGAGCCTGGTGGCTGGCCAATGGCATTA
CAACAGGTATTTGATAAAAAAGAATTGCAATCGCTACAGGCCGACAACGTTCACTGGATAAAGATTCAAT
TCCCTGAAAATATTGCTACTTCCGTATTACAGGATGTGGTGTGCCATATCAATTGCTTTCCTGTTATCAA
CGGCAGGCTGCACGAAACGCTGCACCACATGCACGACATCCTGAATATTGTGCCCCTGTATATCAATGAT
ACTTTCTTTGACCTGCACGAGATCACCGACCAGGATAATCATATTTATAATATTCGTGCATTGGAGAAAA
ATGCCCGGGAAAAACTAACGGTGATCCTGCGCCAGGGTGGAGTAGGGCGCTTTGATGAACGCGACGCTAC
CATGATCATCGAGAACATTGTTCAGTTGCTGAGCGATGAAAGCGCTGCCTTCTCGGTGCTGGGCCGGGAT
TTTTTGTCGGGCGAATTAAAGCAGTTGCAAACGATCATTTACAAGCTGGAACAGCAAATGATCACCCGCG
AACTGAACCGCGAGTACACCCCCTTCCTGGTGGTGCGAAAAGACGACAAGGCAAAACTGAATAACCTTAC
CATCTCCTACTGGAGCACTGCGGCTGAACAGGGAAACGATATAAAGGCAGGCACCACGCTGCAATCGTAT
AAAACATCCAGTTTATACCAGGGTAATTGTACGCTGATCACCACCACCATTGGCGGCCGCAACCGGTTAA
GCGCCTCGGAAAGCATTACAGCGTATAAATCGGCCCTGTTATCGCGGGACAGGTTGATCAGCCTCGAGGA
CATAAAGATCTTCTGCCGTTTGCAATTGGGCAATACGGCCAAACATATTGAAGTAAAGAAAGGCGTGATG
GTGCCGCGCCAGGTATCGCAGGGTTTTATCCGAACCATAGACGTTACCATTAAACTGAGCCGGAAAGACT
TTATGGATGCGCAGGAGAAAAACCAGCTGCAGTACTGGAAGGAAAGTTTAGTGCTGAAGTTGGCTTCCAA
ATCAGCCGGATTGACTCCGTTTAGAGTATTTATAGAACAAGAGAATTAA