SecReT6
Protein ID: 375145914
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2611
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3240647..3241081 [-]
ProductgpW/GP25 family protein
NoteTssE
UniProt IDG8TR37
KEGG IDnko:Niako_2611
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.60E-14, Aligned region: 24..127
Protein Sequence: 144 a.a.     [Download]
>gi|375145914|ref|YP_005008355.1| gpW/GP25 family protein [Niastella koreensis GR20-10]
MRLKYYTLPLDPDLLMQKKEHPGCSLKQSVGHHLHLIITTAFGEMQSDVDFGNSIWDHDFDNLTARTRQQ
EWMKESLLQAIRKHEKRLDAIKVDVLVKQEEVNALSTERRVKKRLDINISARLTATSEDITFRDSFFVSP
LSYS
 
Nucleotide Sequence: 435 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3241081-3240647 Niastella koreensis GR20-10 chromosome, complete genome
ATGCGGCTTAAGTATTATACCTTACCATTGGATCCCGACTTGCTGATGCAAAAGAAAGAGCATCCTGGTT
GTTCCTTAAAACAATCTGTAGGCCATCACCTGCATCTTATTATTACCACCGCATTTGGCGAAATGCAAAG
TGATGTTGACTTTGGCAATTCCATCTGGGACCATGATTTTGATAATCTTACTGCCCGCACCCGGCAACAG
GAATGGATGAAAGAATCCCTGTTACAGGCCATTCGCAAACATGAAAAAAGACTGGATGCCATTAAAGTAG
ATGTACTGGTTAAACAGGAAGAAGTAAACGCACTATCTACAGAACGACGCGTTAAAAAACGCCTCGATAT
TAATATTTCCGCCCGACTCACGGCTACAAGCGAAGACATTACTTTCCGCGACAGCTTTTTTGTGAGCCCG
TTATCATATAGTTAA