SecReT6
Protein ID: 37524366
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0353
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]372677..377092 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ7N9I0
KEGG IDplu:plu0353
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 450..484
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 496..531
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 544..553
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 558..595
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 604..639
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 644..680
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 686..720
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 707..740
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 749..783
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 776..807
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 813..845
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 833..870
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 874..906
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 1026..1045
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 1035..1081
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 1108..1121
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 1134..1153
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 1139..1168
RHS_repeat [PF05593], Evalue: 9.40E-53, Aligned region: 1316..1329
PAAR_motif [PF05488], Evalue: 8.80E-19, Aligned region: 30..47
PAAR_motif [PF05488], Evalue: 8.80E-19, Aligned region: 117..183
DUF4150 [PF13665], Evalue: 0.0013, Aligned region: 119..139
DUF4150 [PF13665], Evalue: 0.0013, Aligned region: 153..174
Protein Sequence: 1471 a.a.     [Download]
>gi|37524366|ref|NP_927710.1| hypothetical protein plu0353 [Photorhabdus luminescens subsp. laumondii TTO1]
MSLGDEIVTRIARVGARHAVHVSPPQGSPGPAAAREGDPIKHASFLGALAGAITGALIGAAVFAAASALV
GLTILTGGLATVAVIALGTAATFALGDVISAASSAVTNMVDSIGPPSGTLTSGSPNVFIEGQPAARATTD
IAVCSKHPAPPLIAQGSETVLINGSPAARVDDKLACGATIKSGAKTVFIGSGQGTYLAVADEFSAWERAI
LIAVEFLVPPSRGALKGLGKLFTKPGQGIQGVLKGAKAGAKKAKALLSNRISCAKKAFRETEGAKRYREA
TKKFFTGDPIDVTTGQLFDQRTDITLGQTLPLVFLRSWVPEEQGLLGPGWTDSFSECALATGDRVEIRTT
EGASLYFALPAAYTHSVNPDHPDFTLSRGEQGYILRHRDSPVSKYFTLPHPSSASKEAPRRWLLTEHRDV
YDNRLRFIYNKHCQLTQVLHSDGPELTLLYNLRGQLTEIRRTDERLQEVMARYHYHDNGRLAEADSTQNF
HLYYEYNAQGLISRWSDGDQTWVDYRYDKQGRCTDSVGAGGFYPVHLDYAPGITRSTTPQGHTTTGHYND
QQLITEIHTPCGGVTRYEYDRWGNLVRQILPEGETLTLTYLADTGRVTSLTEATGAVWQYSYEADSLQLT
GMTDPLQRTWLPQYDEQGQPAGFIAPDGRKTTLTRNAFGLVTSETDPDGNSRTQEYDKHQRLVRVLDEEN
RTVSLGYDSQDRLRSLTAAGALWRWRYDRHHRVAVSDRPDNQLEHFTHDRHGNLTCWTDARGVKWQVEYG
PFDLPVARRDGEGHRWQYRYDADTLQLTQVINPQGETYSYTLDADGRVITEQDYAGTQWHYRYDRSGNCI
EKRDGEENVTRYDYDAARRLTTLHTPEGPTRYHYDSVGRLLTVDSPDSTLHFEYDGQDRIVREIQPHGEI
QRHYPDNRTAERQLLTGETAPVTGPARFSGQTHPGRWQSRREVNRVGELITLTLAGQAPLTIERDDAGRD
TGRYVDGGFILRQQYSLMGQLTAQRAGRNPYFFRPAEPDEIEGPAYAGVARRYEYDTALNLTAASDDGQQ
VNYLLNGNGQVISVGEGRTLREHYQYDETGYPSRRFDGVQEIMGETLYQEGHRLNWVGSHRFVYDRAGRM
QEKQFLAEGCRLALTKYRWNSQNQLTGLITPDGIPWEYRYDAFGRRTEKRCIQSGKLTTYLWDGNVPAEI
REYQHGRLKMIRHLVFDGWELVAQQTQAFTLNLDNRVELMAGEVQTQYAVSAPTGEPLALFDPAGKRVWR
RPKQSLYGLRLGGYGENPQLDPGLRFAGQLFDEESGLFYNRFRYYLPEATCYLSPDPTGLWGGENTYRYV
QNPTKFIDPLGLAGENVFIHYTNKAGFDGIMKSGVLHPNVSGKVYITDVLMSPKDVMRDLLINNPNHIGR
GDYAIIFKIDPGERGNIRSPSRLEYTHEGKLKLNNILYAGKNPYAILEHLDYDTRLKLTDNQVKIRKCGG
K
 
Nucleotide Sequence: 4416 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c377092-372677 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTCACTTGGTGATGAAATCGTCACCCGGATAGCGCGGGTTGGCGCCCGGCACGCGGTGCACGTCTCCC
CGCCACAGGGCTCCCCCGGTCCGGCCGCCGCCCGTGAGGGCGACCCGATTAAACATGCCAGCTTCCTGGG
GGCGCTGGCGGGTGCCATTACCGGCGCACTGATAGGGGCGGCGGTCTTTGCCGCGGCATCGGCACTGGTG
GGACTGACCATTCTCACCGGGGGATTAGCCACCGTCGCGGTCATTGCGCTGGGAACCGCCGCCACATTTG
CCCTGGGCGATGTCATCAGCGCCGCCAGTTCGGCCGTCACGAACATGGTGGACAGCATCGGCCCGCCGAG
CGGCACCCTGACGAGTGGCTCCCCCAATGTCTTTATCGAAGGCCAACCGGCGGCCAGAGCCACCACCGAT
ATCGCCGTTTGCAGTAAACACCCGGCGCCGCCCCTGATTGCCCAGGGCAGTGAAACCGTGTTGATTAACG
GCTCGCCGGCGGCCCGGGTGGATGACAAACTGGCGTGTGGCGCCACCATAAAATCCGGGGCCAAAACGGT
GTTTATCGGCTCCGGTCAGGGAACTTACCTGGCAGTCGCCGACGAGTTTTCCGCCTGGGAACGGGCGATA
CTGATAGCGGTTGAATTTCTGGTGCCGCCGTCACGAGGCGCCCTTAAGGGGCTGGGTAAGCTGTTTACCA
AACCCGGTCAGGGAATTCAGGGGGTATTGAAAGGCGCGAAGGCGGGTGCTAAAAAGGCTAAGGCGCTCCT
CTCAAATCGAATTTCCTGTGCCAAAAAAGCTTTCAGAGAAACTGAAGGGGCAAAACGTTACCGGGAAGCG
ACGAAAAAATTCTTTACCGGCGACCCGATTGACGTCACCACCGGCCAGTTGTTTGACCAGCGGACCGACA
TCACCCTCGGCCAGACCCTGCCGCTGGTGTTTCTGCGCAGCTGGGTGCCGGAGGAACAGGGCTTACTGGG
GCCGGGCTGGACGGACAGCTTCTCCGAATGCGCCCTTGCCACCGGCGACCGGGTAGAAATCCGCACCACC
GAAGGGGCTTCTCTCTATTTTGCCTTACCGGCCGCTTATACCCACAGTGTTAACCCGGACCACCCGGACT
TTACCCTGAGCCGGGGAGAACAGGGATATATTCTCCGTCACCGTGATTCACCGGTCAGCAAATATTTTAC
CCTGCCCCATCCGTCATCCGCCTCAAAAGAGGCACCCCGGCGCTGGTTGCTGACGGAACACCGGGACGTG
TATGACAACCGGCTGCGGTTTATCTATAACAAGCACTGTCAACTGACACAGGTTCTCCACAGTGACGGGC
CGGAGTTGACGCTGCTTTATAACCTGCGCGGACAACTGACAGAGATACGCCGCACCGATGAAAGGTTACA
GGAAGTGATGGCCCGTTATCACTACCATGACAACGGCCGGCTGGCGGAAGCGGACAGTACTCAGAACTTC
CACCTGTACTATGAATATAACGCGCAGGGCCTGATAAGCCGCTGGTCCGATGGCGACCAGACCTGGGTGG
ATTACCGTTATGATAAACAGGGGCGCTGTACTGACAGTGTGGGAGCCGGCGGCTTCTATCCGGTCCATCT
GGATTATGCCCCCGGCATAACCCGCTCCACCACCCCACAGGGGCACACCACCACCGGGCATTACAACGAC
CAGCAGTTAATCACTGAAATCCACACCCCGTGCGGCGGCGTGACCCGTTATGAATACGACCGCTGGGGCA
ATCTGGTCAGACAGATATTACCGGAAGGGGAAACCCTGACGCTGACTTATCTGGCCGATACCGGCCGGGT
CACTTCGCTGACGGAGGCGACCGGCGCGGTATGGCAATACAGCTATGAGGCTGACAGCCTGCAACTGACC
GGCATGACCGACCCGCTGCAACGCACCTGGCTGCCCCAGTATGATGAACAGGGCCAGCCGGCCGGATTTA
TTGCGCCGGACGGCCGGAAAACCACGCTGACCCGCAATGCTTTCGGGCTGGTGACATCCGAAACAGACCC
GGACGGCAACAGCCGCACACAGGAATATGATAAGCATCAGCGGCTGGTGCGGGTGCTGGATGAAGAGAAC
CGGACCGTCAGTCTGGGTTATGACAGCCAGGACCGGCTGCGCAGCCTGACCGCGGCAGGGGCGCTGTGGC
GCTGGCGTTACGACCGTCATCACCGGGTGGCGGTCAGCGACCGGCCGGACAACCAGCTGGAACACTTCAC
CCATGACCGCCACGGGAACTTAACCTGCTGGACCGATGCCCGCGGTGTGAAATGGCAGGTCGAGTATGGC
CCGTTTGACCTGCCGGTCGCCCGGCGTGACGGCGAGGGGCATCGCTGGCAGTATCGTTATGATGCCGACA
CGCTGCAACTGACGCAGGTGATTAACCCGCAGGGGGAAACCTACAGCTACACCCTGGATGCCGACGGGCG
GGTTATCACCGAGCAGGATTATGCCGGCACGCAGTGGCATTATCGCTATGACCGGTCGGGGAACTGCATT
GAAAAGCGGGACGGGGAAGAGAACGTGACCCGCTATGACTATGATGCTGCCCGCCGGCTGACGACGCTGC
ACACCCCGGAAGGCCCCACCCGTTATCATTACGACAGCGTGGGCCGGCTGTTAACCGTGGACTCCCCGGA
CAGCACCCTGCATTTTGAATATGACGGGCAGGACCGGATAGTGCGGGAAATTCAGCCGCACGGAGAAATT
CAGCGTCACTACCCGGATAACCGCACCGCAGAACGGCAGTTGCTGACCGGCGAAACAGCGCCGGTCACCG
GCCCGGCCCGGTTTAGCGGTCAGACCCACCCCGGCCGCTGGCAGAGCCGGCGGGAAGTTAACCGGGTGGG
AGAACTGATTACGCTGACGCTGGCAGGGCAGGCACCCCTGACCATCGAACGGGATGACGCCGGCCGGGAT
ACGGGACGTTATGTGGACGGGGGATTTATTCTGCGCCAGCAGTACAGCCTGATGGGCCAGTTAACCGCGC
AACGGGCCGGCCGCAATCCCTATTTTTTCCGGCCGGCTGAACCGGACGAGATTGAGGGACCCGCTTACGC
GGGCGTGGCCCGCCGGTATGAATACGATACCGCGCTGAATCTGACCGCCGCCAGTGATGACGGGCAGCAG
GTCAATTATCTCCTCAACGGCAACGGCCAGGTGATTTCGGTGGGGGAGGGCCGGACACTGCGCGAGCATT
ATCAGTATGATGAAACGGGGTACCCGTCAAGACGGTTTGACGGGGTGCAGGAGATTATGGGGGAAACCCT
CTATCAGGAGGGCCATCGCCTGAACTGGGTGGGCTCGCACCGGTTTGTTTACGACCGGGCCGGCCGCATG
CAGGAGAAACAGTTTTTAGCGGAAGGGTGCCGGCTGGCGCTGACGAAATACCGGTGGAACAGCCAGAATC
AGCTGACCGGGCTTATCACCCCGGACGGGATACCGTGGGAATATCGCTATGACGCCTTCGGACGGCGGAC
AGAAAAACGGTGTATCCAGAGCGGTAAGCTGACCACCTATCTGTGGGATGGGAATGTGCCGGCGGAAATC
CGCGAATATCAGCACGGCCGGCTGAAAATGATCCGCCATCTGGTGTTTGACGGCTGGGAACTGGTGGCGC
AGCAGACGCAGGCGTTTACGCTTAATCTGGATAACCGGGTGGAGCTGATGGCCGGGGAGGTGCAGACCCA
GTATGCGGTCAGCGCCCCGACCGGCGAGCCGCTGGCGCTGTTCGACCCGGCAGGCAAACGGGTGTGGCGA
CGACCGAAGCAGTCCCTGTACGGGCTGCGGCTGGGCGGATACGGCGAAAACCCGCAGCTGGACCCGGGCC
TGAGATTTGCGGGGCAACTTTTTGATGAAGAAAGTGGTTTATTTTATAACCGATTTCGCTATTATTTGCC
GGAAGCGACGTGCTACCTCAGCCCTGATCCAACTGGCCTCTGGGGTGGTGAGAATACCTATCGCTATGTG
CAAAATCCCACGAAATTTATTGACCCTCTAGGGCTTGCTGGTGAAAATGTATTTATTCACTATACAAATA
AAGCGGGTTTTGACGGCATTATGAAGAGCGGTGTTCTTCATCCAAACGTCAGTGGAAAAGTTTATATAAC
GGATGTACTAATGTCTCCAAAAGATGTAATGAGAGATTTATTGATAAACAACCCCAATCATATAGGACGA
GGAGACTATGCGATTATTTTCAAAATAGATCCAGGGGAAAGAGGAAATATCCGCTCACCTTCTAGATTAG
AATATACTCATGAAGGAAAGTTGAAATTGAATAATATTCTGTATGCCGGTAAAAACCCATATGCCATATT
AGAACATCTTGATTATGATACGAGACTCAAACTCACTGATAATCAAGTTAAAATCAGAAAGTGCGGAGGA
AAATAA