SecReT6
Protein ID: 37524368
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0355
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]377581..379476 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7N9H8
KEGG IDplu:plu0355
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-76, Aligned region: 51..350
Phage_base_V [PF04717], Evalue: 3.90E-23, Aligned region: 389..481
Protein Sequence: 631 a.a.     [Download]
>gi|37524368|ref|NP_927712.1| hypothetical protein plu0355 [Photorhabdus luminescens subsp. laumondii TTO1]
MSFQKKTANAGNLAQQIADRLSPQSAGGLQFTLTAGGLPPHTFVVAGFTLHEALSTPFTLTVSLASADPA
IDFAAVLDQSATLTILRAGKVERTVTGMVASFVQGNTGKHQTRYDMTIRPDMWRTTLRQNARIFQQQDIK
TILTTLLKENGVRDVAFSLRNPHPEREFCVQYRETDFDFLQRLTAEEGIFYFFEFTGNKNTLVFADDAGS
VVKGPVLPYHPDDAEQARQLCITRLTRQAQVRPAVVELKDYTFKNPAWAAEFRHQMREQDLQHTGYEHFD
FPGRFKDEQHGADFTRYRLEALRNNALTGDGDSNAATMQPGVLFTLTGHPRPDLNRCWQLVGVTHHGSQP
QALEQAAGESGTVMRNDFTFIADNQHWRPAPLPKPAMEGPQIAKVVGPAGEEIYCDAYGRIRLQFLWDRY
GRSNDSSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLNGDPDQPIVTGRTYHASNLPPGALPGSKTQM
TFRSKTHKGDGYNELRFEDAKGSEALALHAQRDMNTVVLNNRETRVMNDHTESIGHNQMLSVRNDRHKEV
TGNEVSAITGLRQITVEKDSLLNVKNNIQIQARAGGIEIATAGGSITIDNAGNISIQGANITINGKQVNV
N
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c379476-377581 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTCATTTCAGAAAAAAACCGCCAACGCCGGCAACCTCGCACAACAAATCGCTGACCGGCTGAGTCCGC
AAAGCGCCGGCGGGTTACAGTTTACCCTCACCGCCGGCGGCCTGCCGCCGCACACCTTTGTGGTGGCCGG
CTTTACCCTGCACGAAGCCCTCTCCACCCCGTTCACGCTGACCGTCAGTTTAGCCAGCGCCGACCCGGCG
ATTGATTTCGCCGCCGTCCTCGACCAGAGCGCCACCCTGACCATCCTGCGCGCCGGCAAAGTCGAGCGCA
CCGTCACCGGCATGGTCGCCAGCTTTGTCCAGGGCAATACCGGCAAACATCAGACCCGCTATGACATGAC
CATCCGGCCCGATATGTGGCGCACCACCCTGCGCCAGAATGCCCGGATTTTTCAGCAGCAGGATATCAAA
ACCATCCTCACCACCCTGCTTAAAGAGAACGGCGTCCGGGATGTGGCGTTCAGCCTGCGCAATCCGCACC
CGGAACGGGAGTTCTGCGTCCAGTACCGCGAAACCGATTTTGACTTTCTGCAACGCCTCACCGCCGAAGA
AGGGATTTTTTACTTCTTTGAATTCACCGGCAATAAAAACACCCTGGTGTTTGCCGACGATGCGGGCTCT
GTCGTCAAAGGCCCGGTGCTGCCCTATCACCCCGACGACGCTGAACAGGCCCGGCAACTGTGCATTACCC
GGCTGACCCGCCAGGCGCAGGTACGGCCGGCGGTGGTCGAGCTCAAAGATTACACCTTCAAAAACCCGGC
CTGGGCGGCGGAGTTCCGTCATCAGATGCGGGAACAGGACCTCCAGCATACCGGCTATGAACATTTCGAT
TTTCCCGGCCGCTTCAAAGACGAACAGCACGGCGCTGATTTCACCCGCTACCGGCTGGAAGCGCTGCGCA
ACAATGCCCTGACCGGCGACGGTGACAGTAATGCCGCGACGATGCAGCCCGGCGTGCTGTTCACCCTGAC
CGGCCATCCCCGGCCTGACCTCAACCGGTGCTGGCAGCTGGTCGGCGTCACCCATCATGGCAGTCAGCCG
CAGGCGCTGGAACAGGCCGCCGGGGAGAGCGGCACCGTGATGCGCAACGACTTTACCTTCATTGCTGATA
ATCAGCACTGGCGCCCGGCCCCGTTACCCAAACCGGCGATGGAGGGCCCGCAGATTGCCAAAGTGGTCGG
CCCGGCCGGCGAAGAAATCTACTGCGACGCCTACGGCCGCATCCGCCTGCAATTCCTCTGGGACCGCTAC
GGCCGGAGCAACGACAGCAGCTCCTGCTGGATACGGGTGACCCAGCCCTGGGCCGGTCAGGGCTGGGGCA
TGCTGGCAATACCGCGGATTGGGCAGGAAGTGGTGGTGGACTTTCTTAACGGCGACCCGGACCAGCCGAT
TGTCACCGGGCGCACCTACCATGCCAGCAATCTCCCGCCAGGAGCCCTGCCCGGCAGCAAAACCCAGATG
ACCTTCCGCTCCAAAACCCATAAAGGGGACGGCTACAACGAACTGCGCTTCGAGGATGCCAAAGGCAGTG
AAGCGCTGGCTTTACACGCCCAGCGGGACATGAACACCGTGGTACTCAATAACCGCGAAACCCGGGTCAT
GAACGACCACACCGAAAGCATCGGCCATAATCAGATGCTTTCGGTCAGAAACGACCGCCACAAAGAGGTG
ACAGGCAATGAAGTCAGCGCTATCACCGGCCTGCGTCAAATCACGGTCGAAAAAGACAGCCTGCTGAACG
TCAAAAATAACATCCAGATACAGGCCCGGGCGGGGGGTATCGAAATTGCCACGGCCGGCGGCAGCATCAC
CATCGACAATGCCGGCAATATCAGCATTCAGGGGGCCAATATCACCATCAATGGCAAACAGGTCAATGTG
AACTGA