SecReT6
Protein ID: 37524371
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0360
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]385973..387406 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7N9H6
KEGG IDplu:plu0360
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 53..112
ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 150..159
ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 421..428
Protein Sequence: 477 a.a.     [Download]
>gi|37524371|ref|NP_927715.1| hypothetical protein plu0360 [Photorhabdus luminescens subsp. laumondii TTO1]
MDIRKQFDWQGLLLTPLSDELISRALDENEPAWEYIDGEMVKLGSLAHSSLNIEEIQRQALQLFSEKSKD
FRLMVHLLRTLQHGSHPAELILAMELLADYIPHYWQAAWPHKPQLKRRLAQQVIKRFDAAQPGFCEQADE
TQREEAQGALAHLAQCWHTDEPALAKEIDQLRPRYARKPQPKPAAAPAEPAETTAPSANTSALTSPPIPD
VTVDSAGEKAWKQTLLTVADLLCERQPDSPVGYRLRRYAIWYTLTTAPMANGTGKTPLAPTSADRTADYL
AKLPAADNALLQQIEQSLTLAPYWLDGHALAAQAAGKLGYHAVADAIRDELRAFLDRLPVLQNLSFSDMS
PFISDATLNWLHPPATATVSSGSTPEQDAIWHCFQQHGLEAALHAAEQYQQQLTEPRDQFYGQLLTAQLL
EQAGMHALAQQHYRQLRQAGQHLSLADWEPGLLAALAEKAPMTAPAKATTANRSVNP
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c387406-385973 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGATATCAGGAAACAATTTGACTGGCAGGGCCTCCTGCTGACCCCCCTGTCGGATGAACTCATCAGCC
GGGCGCTGGATGAAAACGAACCCGCCTGGGAATATATCGACGGGGAGATGGTTAAGCTGGGATCACTGGC
CCATTCCAGCCTGAATATTGAAGAGATCCAGCGTCAGGCGCTGCAACTGTTCAGCGAAAAAAGCAAAGAT
TTCAGACTGATGGTTCATTTGCTGCGGACACTGCAACACGGCAGTCATCCCGCTGAACTCATCCTGGCAA
TGGAGCTGTTAGCCGATTACATCCCGCATTACTGGCAGGCAGCCTGGCCACACAAACCGCAGCTCAAACG
CCGCCTGGCGCAACAGGTGATTAAACGGTTTGACGCTGCGCAACCCGGCTTCTGCGAACAGGCGGATGAG
ACGCAGCGCGAAGAGGCGCAGGGCGCACTGGCACATCTGGCACAATGCTGGCATACCGATGAACCGGCTC
TGGCTAAAGAGATCGACCAGTTACGCCCCCGCTATGCCCGTAAACCTCAGCCCAAACCGGCAGCCGCGCC
GGCTGAACCGGCCGAAACGACAGCACCATCGGCAAACACTTCAGCACTGACATCCCCCCCCATACCGGAT
GTCACCGTAGACAGTGCCGGTGAAAAAGCCTGGAAACAGACGCTCCTGACCGTGGCTGACCTGCTGTGCG
AACGCCAGCCTGATTCCCCTGTCGGTTACCGTCTGCGTCGTTATGCTATCTGGTACACCCTGACCACAGC
ACCGATGGCGAATGGCACCGGCAAAACACCGCTGGCACCGACGTCGGCAGACCGCACCGCCGATTATCTG
GCGAAACTCCCGGCGGCGGATAACGCCCTGCTGCAACAGATAGAACAGAGTCTGACCCTGGCCCCTTACT
GGCTGGACGGACACGCTCTCGCGGCGCAGGCCGCCGGCAAACTGGGTTACCACGCCGTGGCTGACGCTAT
CCGCGATGAACTCCGGGCCTTTCTTGACCGTCTGCCGGTCCTGCAAAACCTGTCTTTCTCCGATATGAGC
CCGTTTATCTCCGACGCCACGCTGAACTGGCTGCATCCCCCGGCGACCGCCACCGTCAGCAGCGGCTCCA
CGCCGGAACAGGACGCCATCTGGCACTGTTTTCAGCAACACGGACTGGAAGCCGCCCTCCACGCCGCGGA
GCAATATCAGCAACAGCTGACCGAACCGCGGGATCAATTCTACGGTCAGTTACTGACGGCCCAGTTACTG
GAGCAGGCGGGCATGCACGCGCTGGCACAACAACATTACCGCCAGCTGCGCCAGGCAGGACAACACCTGT
CACTCGCCGACTGGGAACCCGGCCTGCTGGCGGCCCTGGCAGAAAAAGCCCCGATGACCGCCCCCGCCAA
GGCGACGACCGCAAACAGGAGCGTTAACCCATGA