SecReT6
Protein ID: 37524374
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0363
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]388853..391498 [-]
Producthypothetical protein
NoteTssH
UniProt IDQ7N9H3
KEGG IDplu:plu0363
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.90E-40, Aligned region: 222..298
AAA_2 [PF07724], Evalue: 7.90E-40, Aligned region: 472..493
AAA_2 [PF07724], Evalue: 7.90E-40, Aligned region: 616..777
AAA [PF00004], Evalue: 7.70E-19, Aligned region: 30..64
AAA [PF00004], Evalue: 7.70E-19, Aligned region: 222..333
AAA [PF00004], Evalue: 7.70E-19, Aligned region: 484..536
AAA [PF00004], Evalue: 7.70E-19, Aligned region: 622..742
AAA_5 [PF07728], Evalue: 5.80E-15, Aligned region: 222..252
AAA_5 [PF07728], Evalue: 5.80E-15, Aligned region: 462..478
AAA_5 [PF07728], Evalue: 5.80E-15, Aligned region: 621..742
ClpB_D2-small [PF10431], Evalue: 2.10E-14, Aligned region: 529..542
ClpB_D2-small [PF10431], Evalue: 2.10E-14, Aligned region: 783..862
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 54..74
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 410..475
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 477..563
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 592..658
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 687..715
AAA_16 [PF13191], Evalue: 8.30E-09, Aligned region: 801..861
AAA_22 [PF13401], Evalue: 4.10E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 4.10E-07, Aligned region: 496..496
AAA_22 [PF13401], Evalue: 4.10E-07, Aligned region: 620..640
AAA_22 [PF13401], Evalue: 4.10E-07, Aligned region: 683..715
DUF258 [PF03193], Evalue: 7.70E-05, Aligned region: 186..239
DUF258 [PF03193], Evalue: 7.70E-05, Aligned region: 622..637
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 222..244
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 616..650
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 749..810
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 619..643
Zeta_toxin [PF06414], Evalue: 0.00033, Aligned region: 222..240
Zeta_toxin [PF06414], Evalue: 0.00033, Aligned region: 462..510
Zeta_toxin [PF06414], Evalue: 0.00033, Aligned region: 620..661
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 202..366
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 508..508
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 622..642
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 692..703
IstB_IS21 [PF01695], Evalue: 0.0018, Aligned region: 216..246
IstB_IS21 [PF01695], Evalue: 0.0018, Aligned region: 621..632
AAA_19 [PF13245], Evalue: 0.0019, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0019, Aligned region: 615..640
Sigma54_activat [PF00158], Evalue: 0.0024, Aligned region: 222..238
Sigma54_activat [PF00158], Evalue: 0.0024, Aligned region: 621..719
Ras [PF00071], Evalue: 0.0069, Aligned region: 222..235
Ras [PF00071], Evalue: 0.0069, Aligned region: 622..662
AAA_33 [PF13671], Evalue: 0.0092, Aligned region: 222..239
AAA_33 [PF13671], Evalue: 0.0092, Aligned region: 465..511
AAA_33 [PF13671], Evalue: 0.0092, Aligned region: 622..638
MobB [PF03205], Evalue: 0.0092, Aligned region: 222..242
MobB [PF03205], Evalue: 0.0092, Aligned region: 621..641
Protein Sequence: 881 a.a.     [Download]
>gi|37524374|ref|NP_927718.1| hypothetical protein plu0363 [Photorhabdus luminescens subsp. laumondii TTO1]
MIQIDLPTLVNRLNPMTRHALEAAAAQCVSQQQPEITVSQLLLQMINTPLSDVRAIFNQAEVDSDLLKEQ
LDQMIPHHQAMVQAYPNFSPMLVEWLQDSWLLASTEMQHQELRSGVMLMTLLFSPLRYLTPQSARLLSGI
NRELLRQNFTQWTAGSAEQPVVENDKNGQNKAAAGSDSLLARFTQNMTEQARQGKLDPVLCRDKEIDLMI
DILCRRRKNNPIVVGEAGVGKSALIEGLALRIIDNRVPEKLHNSELMTLDLGALQAGAAVKGEFEKRFKG
IMNEINQSSVPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWGEYKKYFEKDAALSR
RFQLIKVAEPTAEEAIIIMRGLRAIYEQSHGVLIDDEALKASAVLSDRYLSGRQLPDKAIDVLDTACARV
AINLTSPPRQISALKNQLHQQQMESDVLAREQRMGLNQHTDRLDELRQQQQETTEKLAALEASWQQQQQL
VQQIIELRRQLLTDETEFTNETKQSETSAEMTTEELIAQLAELNEQLEQLQQQQTLISPHVDKNQIATVI
AEWTGVPLNRLSQSELSVVTELPMHLGQSIKGQDLAIQCLHQHLLTARADLRRPGRPLGAFLLVGPSGVG
KTETVLQIAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVE
KAHPDVLNLFYQAFDKGELADGEGRVIDCKNVVFFLTSNLGYQTIVDNADKPAEMHDRLYPELAAFFKPA
LLARMEVVPYLPLGHDTLKTIIQGKLARLDNLLRQRFNADVTLSDEVVEEILQRATRTENGARMLESIID
GALLPPLSLLLLQKMAAGKQIRTIQLTVNDHQFNAVVEEIP
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c391498-388853 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGATTCAGATTGATCTACCTACACTAGTTAATCGCTTAAATCCGATGACTCGGCACGCTCTGGAAGCGG
CGGCAGCGCAATGTGTCAGCCAACAGCAACCTGAGATCACGGTTTCACAGCTATTGTTGCAAATGATCAA
CACCCCTCTCAGTGATGTCAGAGCGATCTTCAATCAAGCCGAAGTAGACAGCGATTTGCTGAAAGAACAA
CTTGATCAGATGATCCCTCACCATCAAGCAATGGTTCAGGCTTATCCTAACTTTTCTCCAATGTTAGTGG
AGTGGTTACAGGATAGCTGGCTGTTAGCATCGACTGAGATGCAACATCAGGAATTACGCAGCGGCGTCAT
GCTGATGACCTTGCTGTTCAGCCCGCTACGTTACCTGACACCCCAATCCGCACGTCTTTTATCGGGCATA
AACCGCGAATTGTTACGCCAGAATTTTACCCAATGGACCGCGGGCTCTGCTGAACAACCGGTTGTGGAAA
ACGATAAAAACGGACAAAACAAAGCTGCCGCCGGGAGTGATAGCTTGCTCGCCCGTTTTACTCAAAATAT
GACAGAACAAGCTCGTCAGGGAAAACTCGATCCTGTTCTATGCCGTGACAAAGAAATTGACCTAATGATC
GATATTCTCTGCCGTCGCCGTAAAAATAACCCGATTGTGGTAGGTGAAGCGGGCGTCGGTAAAAGTGCGC
TCATTGAAGGGTTGGCTCTGCGCATTATCGACAACCGAGTGCCGGAAAAACTGCATAACAGTGAATTGAT
GACACTGGATCTGGGGGCACTACAAGCAGGTGCGGCGGTAAAAGGTGAATTTGAAAAACGTTTCAAAGGC
ATTATGAATGAAATAAATCAGTCATCCGTACCGATTATTCTGTTCATCGATGAAGCTCATACCCTGATTG
GCGCCGGTAATCAACAAGGCGGACTGGATATCTCCAACCTGCTAAAACCCGCTCTGGCACGGGGTGAATT
GAAAACAATTGCTGCAACCACTTGGGGAGAATACAAAAAATATTTCGAAAAAGATGCGGCCCTCTCCCGC
CGTTTTCAACTCATTAAAGTGGCCGAACCGACCGCGGAAGAAGCCATCATTATTATGCGTGGCCTGCGGG
CAATCTATGAACAATCTCATGGCGTATTAATCGATGATGAAGCGCTAAAAGCCTCTGCGGTATTAAGCGA
CCGTTACCTCTCTGGACGCCAGTTGCCAGACAAAGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTG
GCCATCAACTTGACGTCACCTCCGCGCCAAATTTCTGCCCTGAAAAACCAACTGCATCAGCAACAAATGG
AATCAGACGTGCTGGCGAGGGAACAGCGCATGGGGCTCAATCAGCATACTGATCGACTGGATGAACTACG
ACAACAACAGCAGGAAACCACAGAGAAATTGGCTGCACTAGAAGCCAGTTGGCAGCAACAACAGCAATTA
GTTCAGCAAATTATTGAACTACGCCGTCAGCTATTAACCGACGAAACAGAATTCACTAACGAAACAAAAC
AGAGCGAAACATCGGCCGAAATGACAACTGAAGAGTTGATTGCACAATTGGCTGAACTGAATGAACAGTT
GGAACAATTACAGCAACAACAAACGCTCATTTCTCCTCACGTGGATAAAAACCAGATTGCAACGGTTATC
GCTGAATGGACTGGCGTGCCACTTAATCGTCTGTCACAAAGTGAACTTTCCGTGGTGACAGAACTGCCCA
TGCACCTGGGACAAAGCATCAAGGGGCAGGATCTGGCTATTCAATGCCTGCATCAGCACTTGTTGACCGC
CAGAGCTGACCTGCGCCGTCCCGGTCGTCCATTGGGCGCCTTCTTGCTGGTAGGACCCAGTGGCGTCGGT
AAAACCGAAACCGTTTTACAGATTGCCGAATTGATGTTTGGCGGACGTCAATATCTGACCACGATCAATA
TGTCGGAATTTCAGGAAAAACACACGGTTTCCCGCCTGATCGGCTCACCTCCAGGCTATGTTGGCTATGG
GGAAGGGGGGGTACTCACCGAAGCTATTCGCCAGAAACCTTATTCCGTCGTCCTGCTTGATGAAGTGGAA
AAAGCGCATCCTGATGTCCTGAACCTGTTCTATCAGGCCTTCGATAAAGGTGAGTTGGCCGATGGGGAAG
GCCGGGTGATTGACTGTAAAAATGTGGTCTTCTTTTTAACGTCCAATTTGGGCTATCAAACTATCGTCGA
TAATGCCGATAAACCGGCAGAGATGCATGACCGGCTTTATCCTGAACTGGCCGCTTTCTTCAAACCCGCC
TTACTGGCGCGAATGGAAGTGGTGCCTTATCTGCCGTTAGGACACGACACCCTGAAAACCATTATTCAGG
GCAAACTGGCGCGCCTCGATAACTTATTGCGTCAACGCTTCAATGCCGACGTCACCCTGAGTGATGAGGT
GGTTGAAGAGATACTGCAACGGGCAACTCGTACTGAAAATGGCGCCCGCATGCTGGAATCGATCATTGAT
GGCGCTTTGTTGCCACCGTTATCTCTGCTGTTATTGCAAAAAATGGCGGCCGGAAAACAGATCCGCACTA
TCCAGCTCACCGTTAACGACCATCAGTTCAACGCGGTGGTTGAGGAGATACCATGA