SecReT6
Protein ID: 37524375
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0364
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]391509..392279 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ7N9H2
KEGG IDplu:plu0364
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.90E-64, Aligned region: 35..240
Protein Sequence: 256 a.a.     [Download]
>gi|37524375|ref|NP_927719.1| hypothetical protein plu0364 [Photorhabdus luminescens subsp. laumondii TTO1]
MKTETINGNPIPTQEVTDNAVHLQYQLPLRGESLNPMIDAATPLLGMVMRLKDMGEQPLPDQLYQQVVTD
IQAIEQLLQTKGYEPGAIISFRYTLCTFIDETALGHGWNSKNEWLQQSLLVRFHNETWGGEKVFQLLDRL
MGEPQRYQHLLEFIYLCFCLGYRGRYKVASQKSDDFERLFRRLHQQLHALRGEAPSIILHNNANERNDRY
RLGKRLTIKHLFWSGITLLAIVYSFYAIRLHNQTQNILQQLNNLLS
 
Nucleotide Sequence: 771 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c392279-391509 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAAACTGAAACCATAAATGGCAATCCTATTCCGACGCAGGAGGTCACTGATAATGCCGTGCATCTTC
AGTATCAGTTACCGCTGCGCGGAGAAAGCCTAAACCCGATGATCGATGCCGCTACACCGCTGCTCGGCAT
GGTCATGCGTCTAAAAGACATGGGCGAACAACCGCTGCCGGACCAGCTTTATCAACAGGTCGTCACTGAT
ATTCAGGCAATCGAACAACTTCTACAAACCAAAGGCTATGAGCCGGGCGCAATTATCTCTTTTCGCTATA
CGCTCTGTACCTTCATTGATGAAACCGCATTGGGTCATGGTTGGAACAGCAAGAATGAGTGGTTACAACA
ATCACTACTGGTTCGATTCCATAATGAAACCTGGGGTGGCGAAAAAGTTTTTCAGTTGCTAGATCGTTTG
ATGGGTGAACCTCAGCGCTATCAACATCTGCTGGAGTTTATCTATCTTTGCTTCTGCCTCGGTTACCGTG
GCCGTTATAAAGTTGCTTCGCAGAAAAGTGATGACTTTGAACGTTTATTCCGTCGATTACACCAACAACT
GCACGCGCTGCGGGGAGAAGCTCCTTCCATCATTCTCCACAATAACGCCAATGAGCGTAATGATCGCTAT
CGCCTGGGTAAGCGTCTGACTATTAAACATCTGTTCTGGAGCGGTATTACGCTGCTCGCTATCGTTTATA
GCTTCTACGCTATCCGTCTGCACAACCAAACCCAGAACATCTTACAACAGCTAAATAACTTACTGAGCTA
G