SecReT6
Protein ID: 37524376
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0365
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]392279..393631 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7N9H1
KEGG IDplu:plu0365
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-148, Aligned region: 19..446
Protein Sequence: 450 a.a.     [Download]
>gi|37524376|ref|NP_927720.1| hypothetical protein plu0365 [Photorhabdus luminescens subsp. laumondii TTO1]
MPGKNRVIWREGLFIKPQHFQQQQKHNDYLAHSRQTSLTSYSYGFSSLTLDKDLLALGRISIIEASGIMP
DGTVFSIPNQDATPQPLDVVNIHENNSKDIYLALPIANDILNEISHSESNHAGAVRYREYMEDIRDLHTD
GGDICQVMLAQLTPVLKQGSEDLSAFSVLPLCQIIEKRPTGTIILDEDFVPTCTSIRVSTQLKNYMDEID
RAMTERGRSLANRIGSPGQQGVADVAEFMMLQLVNRVQPWFTHYAGQAILHPQDFFTQLIQTCGELRTFT
HESRQVGNMPIYKHDDLTETFKEVMILMREAMGVVLTPRAIPIKLQTQANGIRVAHIHDRNVLTNAEFIL
AIRAQVPHDQLLRKFAQQTKVTSAERIREMVSIQLPAVALAALPSAPRQLPYHAGYTYFRLEQQGDAWKD
ILKGNSIAFHVSGEFPGLDMQFWAVRNGSA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c393631-392279 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGCCAGGCAAGAATCGGGTGATTTGGCGCGAAGGATTATTCATCAAGCCACAACACTTTCAACAACAAC
AAAAACATAATGACTATCTGGCTCATAGCCGCCAGACGTCCTTAACTAGTTATAGTTATGGCTTCAGTTC
TCTGACACTGGATAAAGACCTTCTCGCTCTAGGACGCATCAGTATCATCGAAGCCAGCGGTATCATGCCA
GACGGCACAGTGTTCTCGATTCCTAATCAGGATGCAACTCCTCAACCGCTTGATGTTGTGAATATTCACG
AGAACAACAGTAAAGATATCTATCTGGCGCTACCAATAGCTAACGATATTCTGAATGAAATCTCTCATTC
AGAATCCAATCATGCAGGAGCTGTGCGCTACCGTGAATACATGGAAGATATCCGTGATTTGCATACAGAT
GGCGGTGATATCTGTCAAGTCATGCTGGCACAACTGACGCCGGTTCTAAAACAGGGTTCAGAAGATCTCA
GTGCTTTTTCCGTACTCCCGCTATGCCAGATAATAGAAAAGCGCCCTACCGGAACTATCATACTGGATGA
AGATTTCGTACCAACCTGTACATCCATCAGGGTCTCTACTCAATTAAAAAATTATATGGATGAAATAGAT
AGAGCGATGACAGAACGAGGCAGATCACTCGCTAACCGGATTGGTTCTCCCGGACAGCAAGGAGTCGCTG
ATGTTGCTGAATTTATGATGCTCCAGCTAGTTAACCGAGTTCAGCCGTGGTTTACCCACTACGCAGGACA
AGCCATTTTGCATCCACAAGATTTTTTCACTCAGCTGATCCAAACCTGTGGTGAACTGAGAACATTCACT
CATGAATCCCGTCAGGTCGGCAATATGCCAATTTACAAACACGACGATCTGACGGAAACATTCAAGGAAG
TCATGATCCTCATGCGCGAAGCAATGGGCGTTGTTCTGACCCCGCGAGCGATTCCAATTAAGCTACAAAC
TCAAGCCAATGGTATCCGGGTGGCCCACATCCATGATCGCAATGTTTTGACGAACGCGGAATTCATTCTG
GCAATCCGCGCACAAGTTCCACATGATCAATTACTCCGCAAGTTTGCTCAACAGACTAAAGTTACATCGG
CTGAAAGGATCCGCGAAATGGTCAGCATCCAGTTGCCTGCCGTAGCACTGGCGGCGCTTCCCTCTGCCCC
ACGTCAGTTGCCTTATCATGCTGGTTACACCTATTTCCGACTTGAGCAACAAGGCGACGCATGGAAAGAC
ATTCTAAAAGGTAACTCCATCGCTTTCCACGTTTCAGGAGAATTCCCTGGATTAGATATGCAATTCTGGG
CGGTTAGGAATGGGAGTGCCTAA