SecReT6
Protein ID: 37524377
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0366
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]393634..394200 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ7N9H0
KEGG IDplu:plu0366
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.90E-39, Aligned region: 23..181
LPAM_1 [PF08139], Evalue: 0.0053, Aligned region: 18..31
Protein Sequence: 188 a.a.     [Download]
>gi|37524377|ref|NP_927721.1| hypothetical protein plu0366 [Photorhabdus luminescens subsp. laumondii TTO1]
MKRSGGNTSWFGSNTVWFVLLAALMLSGCSSAWQATKKVGQVVWDPSTPVGQPANLPSTVAITLLAEPDI
NPNKNGEATPVEMHLLYLSEDSRLLAADYDQLASDKLDKALGKNYIDHQDYTLLPGQYKPLPVIPLEKNS
RYIGVIVRYADINQSEWKKVIRVKDTGQQYHILVHIRANEVELRKEEQ
 
Nucleotide Sequence: 567 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c394200-393634 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAGCGCTCCGGCGGTAATACCTCATGGTTCGGTAGTAATACCGTATGGTTTGTATTGCTGGCAGCGC
TGATGTTAAGCGGTTGTAGCAGTGCATGGCAGGCAACGAAGAAAGTCGGACAGGTAGTCTGGGACCCATC
AACTCCAGTTGGTCAACCTGCGAACTTACCTTCCACCGTCGCGATCACTTTGCTGGCAGAACCTGATATT
AACCCCAATAAAAATGGAGAAGCCACTCCGGTTGAAATGCATCTGCTCTATCTCAGTGAAGATTCCCGTC
TACTTGCCGCTGATTATGACCAACTGGCGAGTGACAAGCTGGATAAAGCACTGGGGAAAAATTATATCGA
CCATCAGGATTACACCTTATTGCCGGGGCAGTACAAACCACTGCCAGTCATCCCGCTGGAAAAAAATAGC
CGTTACATCGGCGTTATCGTTCGCTATGCCGATATTAATCAATCCGAATGGAAAAAGGTCATCCGTGTGA
AAGACACAGGACAGCAATACCACATTCTGGTGCATATCAGAGCGAACGAAGTTGAACTTAGAAAAGAGGA
GCAATAA