SecReT6
Protein ID: 37524378
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0367
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]394200..395486 [-]
Producthypothetical protein
NoteFha
UniProt IDQ7N9G9
KEGG IDplu:plu0367
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|37524378|ref|NP_927722.1| hypothetical protein plu0367 [Photorhabdus luminescens subsp. laumondii TTO1]
MEKQQPTLSLRVINSDQLESGKAASCLFSTQGGTVGSSESHLWSVQDQQGNINPSQFTIQWRDDAFCLQM
IAGPLFVNQSPLTSGAGFIRLQQADEITIGKLVIKSYISFSDTDRIDPMTVSPESLVSSYSNPLDAMMEK
DPAQDSAFTDHGSLAPTIKHDFSHDPLKVLDSENLTTLDQTSVSNEVDQSLQQDHYRTPLFFSSLSDNRG
NAMDQDFVDLPGISSPFNEQYQDMEQQHVAITPLMRGLNTQLPLHNSQQANDFLEEMGKTMKAAIEGLLV
LQRTQHGLRDKQLRPIEDNPLRLNMDYNTTMQVMFADQKSPVHLSAPSAVAESLHNLQLHYQANRIAITA
ALNTMLDAFSPEHLLNRFAQYRRSNETQEKDATWAWEMYTSYYRELASSRQQGFEKLFGEVYEQAYDRAL
RQGLEDSQ
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c395486-394200 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGAAAAACAACAGCCAACTCTCTCATTACGAGTGATCAACAGCGATCAATTGGAAAGCGGCAAAGCGG
CTAGCTGCCTATTCTCGACTCAAGGTGGCACAGTCGGCAGCAGTGAAAGCCATCTTTGGTCCGTTCAAGA
TCAACAAGGTAATATCAATCCATCACAATTTACTATCCAGTGGCGTGATGACGCATTTTGCTTACAAATG
ATTGCGGGTCCCCTGTTTGTGAATCAGTCACCCTTGACTTCTGGCGCCGGTTTCATCCGCCTGCAACAAG
CGGATGAAATTACCATTGGTAAACTGGTGATCAAAAGCTATATCAGTTTTTCCGACACAGATCGTATTGA
TCCAATGACAGTATCACCGGAATCACTGGTCTCCAGCTATAGCAATCCACTGGACGCTATGATGGAAAAA
GATCCTGCTCAAGATTCCGCTTTCACTGATCATGGTTCTTTGGCCCCCACGATCAAACACGATTTCAGCC
ATGATCCACTCAAGGTTCTCGATAGCGAAAATCTGACCACTCTGGACCAGACGTCAGTGAGTAACGAGGT
AGACCAAAGCCTGCAACAAGACCACTACCGCACCCCATTATTTTTCTCTTCCCTCTCAGATAACAGAGGC
AATGCTATGGATCAGGATTTTGTTGATTTACCCGGTATCTCTTCGCCTTTTAATGAACAGTATCAGGACA
TGGAACAGCAACATGTTGCTATCACGCCATTGATGCGAGGGTTGAACACACAATTGCCTTTGCATAACAG
CCAACAAGCTAACGACTTTCTGGAAGAAATGGGTAAAACCATGAAAGCGGCCATTGAAGGTCTACTGGTA
CTGCAACGTACACAGCATGGGCTGCGTGATAAACAATTGCGCCCTATTGAAGATAATCCGTTACGGCTGA
ACATGGATTACAACACCACCATGCAAGTGATGTTTGCGGATCAAAAAAGCCCGGTACATCTCTCTGCCCC
CTCCGCTGTCGCTGAAAGCTTACATAACCTGCAATTGCATTATCAGGCTAACCGGATTGCGATCACTGCC
GCATTGAACACCATGCTGGATGCTTTCTCACCGGAACACCTACTGAATCGTTTTGCCCAATACCGCCGCA
GCAATGAAACACAGGAAAAAGATGCAACCTGGGCATGGGAAATGTACACCAGTTACTACCGCGAACTGGC
TTCCAGCCGCCAACAAGGGTTCGAAAAACTGTTCGGTGAAGTCTATGAGCAAGCTTATGACCGTGCTCTA
CGTCAAGGTTTAGAGGATAGCCAGTAA