SecReT6
Protein ID: 37524379
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0368
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]395492..396472 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7N9G8
KEGG IDplu:plu0368
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-86, Aligned region: 2..313
Protein Sequence: 326 a.a.     [Download]
>gi|37524379|ref|NP_927723.1| hypothetical protein plu0368 [Photorhabdus luminescens subsp. laumondii TTO1]
MSRYNFHQLVELFNQLAVAWEKTGQTNRPDREAIQFKSSASLAFPTRDIVSAKRSKEGRFQVEVSFLGLH
GSQSPMPGYYLDSLAWEDAQDENRLTNFLNIFNHSSIVMLHQIWRKYRYYICFDKNGQDDFSQRMFALVG
LGSNVNRSHLNINHSKMLAYAGLLASPGRSPEVICSLVSHCFDLPDVTVHGWQIRKIAIEPSQQNRLGGM
LKIRGQKQKVKQSVIGKNFFLGSWVRSCNSKFILCINNLSREHFLSFLPDGKNFLPLVMFLCFVLRDQMA
WDLRLGLAENQAGGMVLGTKLNNNLGWTSFLGEPEKKPFITISVNG
 
Nucleotide Sequence: 981 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c396472-395492 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGTCAAGGTATAACTTTCATCAATTGGTCGAATTGTTCAACCAATTGGCGGTAGCGTGGGAAAAAACTG
GGCAAACCAACCGTCCGGACCGTGAAGCAATTCAGTTTAAATCCAGCGCCAGCCTGGCTTTCCCAACCAG
AGATATTGTCTCTGCGAAACGTTCTAAAGAGGGACGTTTCCAGGTGGAAGTCTCTTTTCTGGGGCTACAT
GGCAGCCAATCGCCTATGCCAGGTTATTACCTTGATTCGTTGGCATGGGAAGACGCCCAGGATGAAAATC
GACTGACTAACTTCCTTAATATCTTCAATCACAGCTCTATTGTCATGCTCCATCAGATCTGGCGGAAATA
CCGTTATTACATCTGTTTTGACAAAAACGGACAAGACGATTTTTCTCAGCGTATGTTTGCTTTGGTGGGA
CTTGGCAGTAATGTGAACCGTTCTCATTTAAATATCAACCATAGCAAAATGCTGGCCTATGCCGGCTTAT
TAGCCAGCCCCGGTCGATCACCGGAAGTGATATGCAGCTTGGTTTCACACTGTTTTGATCTACCGGATGT
TACGGTACACGGCTGGCAAATCAGAAAAATCGCTATCGAGCCATCACAGCAAAACCGTTTAGGTGGAATG
CTGAAAATAAGGGGACAGAAACAAAAAGTTAAACAGTCTGTAATAGGAAAAAACTTTTTCCTCGGTTCAT
GGGTGAGAAGCTGCAATAGTAAATTTATTTTATGTATCAATAATCTCTCTCGTGAACACTTCTTGTCATT
TCTCCCAGACGGCAAGAATTTCCTGCCATTGGTAATGTTTCTCTGTTTTGTCCTGCGTGATCAGATGGCT
TGGGATCTGCGTCTTGGCTTGGCCGAAAACCAAGCGGGCGGCATGGTACTTGGCACGAAATTAAACAATA
ACCTAGGGTGGACCAGCTTTCTTGGCGAACCGGAAAAGAAACCCTTTATCACGATTTCAGTGAATGGATA
A