SecReT6
Protein ID: 37524380
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0369
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]396508..398355 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7N9G7
KEGG IDplu:plu0369
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-211, Aligned region: 3..615
Protein Sequence: 615 a.a.     [Download]
>gi|37524380|ref|NP_927724.1| hypothetical protein plu0369 [Photorhabdus luminescens subsp. laumondii TTO1]
MSLEKYFREELDYLRQLGRQAAIEHPHLASFLSEQGSDPDVERLLEGFAFLAGNLRAKIDDQFPELTHGL
LHMLWPNYLRPTPSMTIIQYTPDDSAITKATQIPRGTQIKSRPLTDDSENDEDEDNYLSNTNTQKTGQDD
HRCTFTLCRDVWLFPMSIRDISVNNSNEQGVIGLNFTSKTELNLQELQLDKLRFYLSGDDYSSTQLYFWL
SYYLEDAKLVVGDTTISLPDFDFVPVGFNREDALLPYPKNAYMGYRVLQEYFCFSEGFLFFDVTGIPKLP
ASLKATDFTLNLYFSEALPPEIKIRQDTFRLHCVPAINLFPMDGEVIRLDGSRDEYPLRASYSHPNRYDI
FSIDKVESWLVGPDGKPKLSRDGRRSYVPFESFHHQIEHESELNTRYFRIRIKESPFRKGLEHYISFVRG
DESQLLLSEENVSIQLTCTNRELPLQLRVGDIDYPLSGSSSFATFRNITRPSVPLYPLMSGEYHWSLISN
MSLNYMTLLDKDALKAVLRTYDLPSRYNRQSSRSSQKRLDAIERIETRQIDRLFKGLPVRGSESTLYIRQ
QAFCSEGELYLFCNILSRFFALYASVNSFHMLKVINLDNQECYQWPEQTGQHALM
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c398355-396508 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTCACTTGAAAAATATTTTAGAGAGGAACTGGATTACCTTAGACAATTGGGGCGACAAGCCGCAATTG
AACATCCTCACCTCGCCTCATTTTTGTCTGAACAAGGCTCTGACCCGGATGTTGAGCGTTTACTAGAAGG
ATTTGCTTTTCTCGCAGGTAATTTACGGGCAAAAATTGATGATCAATTCCCTGAGCTGACTCATGGATTG
TTACACATGCTATGGCCAAATTACCTGCGGCCAACGCCTAGCATGACCATTATCCAATATACACCTGATG
ATAGTGCCATCACAAAAGCGACGCAGATCCCGCGTGGAACTCAAATCAAAAGCCGTCCGCTGACGGATGA
TAGCGAAAATGATGAGGATGAAGATAATTACTTAAGCAATACCAATACTCAAAAAACAGGCCAAGACGAT
CATCGCTGTACTTTCACTTTATGCCGTGATGTTTGGCTGTTTCCGATGTCTATCCGGGACATTTCGGTCA
ATAATAGTAATGAGCAGGGTGTCATCGGTCTGAATTTCACCTCAAAAACAGAACTTAACTTACAAGAACT
GCAACTTGATAAACTGCGTTTTTATCTAAGCGGCGATGATTACAGCAGTACACAACTCTATTTCTGGCTT
AGTTATTACCTTGAAGATGCAAAACTTGTTGTAGGCGATACCACGATTTCATTACCGGATTTTGACTTCG
TTCCAGTGGGTTTTAATCGGGAGGACGCCCTATTGCCTTACCCGAAAAATGCCTATATGGGTTATCGCGT
CTTACAAGAGTACTTCTGTTTTTCCGAAGGTTTTCTGTTTTTCGATGTCACTGGCATCCCTAAATTACCG
GCAAGTCTTAAAGCCACAGATTTCACGCTAAATCTCTATTTCTCAGAAGCTCTGCCGCCAGAAATCAAAA
TCCGTCAGGATACTTTTCGGTTGCATTGTGTTCCGGCAATCAATCTCTTTCCAATGGATGGTGAAGTTAT
TCGATTGGATGGTAGCCGGGACGAATATCCATTGAGAGCGAGTTATAGCCATCCTAATCGCTACGATATT
TTCTCTATTGATAAAGTAGAAAGCTGGCTAGTCGGGCCTGATGGTAAACCTAAACTAAGCCGCGATGGTA
GACGATCTTATGTGCCATTCGAAAGTTTTCACCATCAAATCGAACATGAAAGCGAACTCAATACTCGCTA
TTTTCGTATCAGAATCAAGGAATCCCCATTTCGCAAAGGGCTTGAGCATTACATCTCTTTTGTCCGTGGT
GATGAATCTCAACTTCTATTAAGTGAGGAAAATGTCTCTATTCAACTGACGTGCACCAATCGCGAACTGC
CACTTCAACTCCGGGTAGGTGATATTGATTACCCTTTATCGGGAAGCTCGTCATTTGCGACATTCCGCAA
CATAACCCGCCCATCCGTTCCACTCTATCCATTGATGAGCGGTGAGTATCACTGGTCGCTTATTTCCAAT
ATGTCACTGAACTATATGACATTATTGGACAAAGACGCACTAAAGGCGGTACTAAGAACTTACGATCTCC
CCAGCCGATATAACCGACAATCCTCACGCTCATCACAAAAACGGCTAGATGCCATTGAACGGATTGAAAC
GAGGCAAATAGACCGACTATTTAAAGGTCTCCCGGTACGTGGTTCGGAATCAACATTGTATATCCGGCAA
CAGGCTTTCTGTTCTGAAGGCGAGCTTTATCTGTTCTGCAACATACTGTCACGCTTTTTTGCCTTATATG
CCAGCGTTAACTCCTTCCACATGTTGAAGGTGATCAATTTAGATAATCAGGAATGTTATCAATGGCCGGA
ACAGACAGGTCAACATGCGTTGATGTAA