SecReT6
Protein ID: 37524381
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0370
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]398357..398797 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ7N9G6
KEGG IDplu:plu0370
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 31..122
Protein Sequence: 146 a.a.     [Download]
>gi|37524381|ref|NP_927725.1| hypothetical protein plu0370 [Photorhabdus luminescens subsp. laumondii TTO1]
MAALHSWNREGSASLFERIQGKNSGSSRQSRMRELLNSIKRHLNHVLNTHPGACQSAADLGVIDLNDATT
TATDFKQSIEQAIEHCITNYEPRISSVTVNAIHDDSDPLLLRFHISAQVSLDDIHDAVEFNIQLDNNRRY
CLERTQ
 
Nucleotide Sequence: 441 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c398797-398357 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGCTGCGCTGCACAGTTGGAATAGAGAAGGCTCTGCCAGCCTGTTCGAGCGTATTCAGGGGAAGAACT
CTGGTTCTTCCCGCCAATCAAGAATGCGTGAGCTGCTCAACTCCATAAAACGGCACCTGAATCATGTTCT
CAATACTCATCCGGGTGCCTGTCAGAGTGCGGCTGATCTTGGCGTCATTGATCTCAATGACGCTACAACC
ACGGCAACTGACTTTAAACAGAGTATTGAGCAAGCAATAGAGCACTGCATCACAAATTATGAACCAAGAA
TATCGTCAGTCACTGTCAATGCAATCCACGATGATAGTGATCCGCTGTTGTTACGTTTTCACATCAGCGC
CCAGGTATCCCTGGATGATATTCATGACGCTGTTGAATTTAATATTCAACTGGATAACAACCGGCGTTAT
TGCCTAGAGAGGACTCAATAA