SecReT6
Protein ID: 37524382
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0371
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]398804..400282 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7N9G5
KEGG IDplu:plu0371
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-187, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|37524382|ref|NP_927726.1| hypothetical protein plu0371 [Photorhabdus luminescens subsp. laumondii TTO1]
MSLHEESSTTLTPGSTTSLLDEIMSQARMTPENDGYHIAKQGVAAFISSILDTGTNEEPVNKLVVDRMIV
ELDKTLSTQVDEIMHAKEFQELESSWRSLKLLVDRTDFRENIKINIIHATKEELLEDFEFSPEIIQSGLY
KHVYSTGYGQFGGEPVAAVIGNYAFSNSSPDIKLMQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIK
DLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYQEDVSKDHEHFLWGNTAYL
LATCLTDSFAKYRWCPNIIGPQSGGTVSDLPVHLFEAMGQIQAKIPTEVLVTDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c400282-398804 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTCCTTGCATGAAGAGAGCAGTACAACATTAACCCCAGGGTCCACTACCTCTTTGCTTGACGAGATTA
TGTCTCAGGCAAGAATGACGCCGGAAAATGATGGCTACCATATCGCAAAACAAGGTGTTGCCGCTTTTAT
CAGCAGCATTTTGGATACCGGTACTAACGAAGAACCTGTCAACAAGCTTGTCGTTGATAGAATGATTGTT
GAGCTTGATAAAACACTCAGCACTCAAGTTGATGAAATTATGCATGCCAAAGAGTTCCAAGAGCTGGAAT
CATCATGGCGTTCACTGAAATTGCTGGTTGATCGTACCGATTTTCGTGAAAACATCAAAATCAACATCAT
CCATGCGACCAAAGAAGAGTTACTGGAAGATTTCGAATTTTCACCAGAAATCATCCAATCAGGCTTATAC
AAACATGTCTACTCAACAGGTTATGGCCAGTTTGGCGGCGAACCGGTTGCGGCGGTCATCGGTAACTATG
CGTTTAGCAATAGCTCACCCGATATCAAACTGATGCAATATGTCAGCGCGGTTGGCGCAATGGCTCACGC
GCCATTCCTCTCTTCCGTTGCACCTGATTTCTTTGGTATCAGTAGCTTTACCGAATTACCAGCGATTAAA
GATCTGAAATCTGTCTTCGAAGGCCCGGCACACACCAAATGGCGTGCGCTGCGCGAATCGGAAGATTCAC
GTTATCTCGGTCTGACAACACCGCGCTTCTTGTTACGTCTACCTTACTCAACCGTCGAAAACCCAATTAA
AAACTTTAACTATCAGGAAGATGTCAGCAAAGATCACGAACATTTCCTGTGGGGTAATACCGCTTATCTG
CTGGCAACTTGTTTGACTGACAGCTTCGCCAAATATCGCTGGTGCCCGAATATTATCGGCCCACAAAGCG
GTGGTACTGTCAGCGATCTACCGGTTCACCTATTCGAAGCAATGGGGCAGATCCAAGCCAAGATCCCGAC
AGAAGTTTTAGTTACCGATCGTCGTGAATTTGAATTGGCGGAAGAGGGTTTTATCACTCTGACGATGCGT
AAAGGCAGTGACAACGCCGCATTCTTCTCTGCCAACTCAGTCCAGAAGCCAAAAGTGTTCCCGAATACCC
GCGAAGGGAAAATGGCGGAAACCAACTATAAATTGGGTACTCAACTGCCCTATATGTTCATCATCAACCG
CCTTGCACACTACATCAAAGTGTTACAGCGCGAGCAGATTGGTTCCTGGAAAGAGCGTCAGGATCTGGAG
CGTGAACTGAACACCTGGCTGAAACAGTACATTGCTGATCAGGAAAATCCACCAACGGATGTCCGTAGCC
GTCGCCCTCTGCGTTCTGCCCAAATTCAAGTTTTGGATGTGGAAGGCGATCCAGGCTGGTATCAAGTGGC
AATGCAGGTTCGCCCTCATTTTAAATATATGGGAGCCAGCTTTGAATTGTCACTAGTAGGCCGTCTGGAT
AAGGAGTAA