SecReT6
Protein ID: 37524383
SecReT6 ID50
T6SS typei1
Gene symbol-
Locus tagplu0372
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]400306..400803 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ7N9G4
KEGG IDplu:plu0372
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|37524383|ref|NP_927727.1| hypothetical protein plu0372 [Photorhabdus luminescens subsp. laumondii TTO1]
MSKNSSGSVAPKERINIKYVPNTGDQVAEIELPLNLLIVGDLKGTKEDTPIEERQAVSVHKNNFNAVMNE
ANINLTFSVPNRLNDNNGDDLPINLEIKSLNDFSPDNVAKKVPELNKLLELREALVALKGPLGNIPAFRT
RLQELLGDEKVREQLLKELEIVNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c400803-400306 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAGTAAAAATAGTTCAGGTAGCGTAGCGCCAAAAGAAAGGATTAATATCAAATACGTTCCGAATACCG
GTGATCAAGTAGCCGAGATTGAATTACCCCTTAACCTACTTATCGTTGGTGACCTCAAAGGAACAAAAGA
AGATACGCCAATTGAAGAACGGCAAGCTGTTTCTGTGCACAAGAATAACTTTAATGCCGTGATGAATGAA
GCCAATATCAATCTCACCTTTAGTGTCCCCAATCGCCTCAACGATAATAACGGAGATGACCTGCCAATTA
ACCTGGAAATAAAATCACTCAATGATTTCTCACCCGATAACGTAGCGAAGAAAGTGCCTGAATTAAATAA
ACTTTTAGAGCTGCGTGAGGCACTTGTCGCACTAAAAGGGCCATTAGGAAATATTCCGGCATTCCGCACC
CGCTTACAAGAGTTATTGGGTGATGAGAAAGTCCGCGAACAACTTCTAAAAGAGCTTGAAATCGTCAATC
AAAAGTAA