SecReT6
Protein ID: 375260546
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18775
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4056792..4057283 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDG8W9B4
KEGG IDkox:KOX_22535, kox:KOX_18775
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|375260546|ref|YP_005019716.1| type VI secretion system protein ImpB [Klebsiella oxytoca KCTC 1686]
MADTFQNEVPKARINLKLALHTGGAQKKVELPLKLLTIGDFSNGKEDRPLSERAKINVNKNNFNSVLSEF
SPEISLTVQNTLAGDSAEENIQLRFADMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EKILKDPALTQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4056792-4057283 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAGGTGCCCAAGGCACGCATTAATTTAAAGCTGGCTCTGCACACAGGAG
GCGCGCAGAAGAAAGTCGAGCTGCCGCTGAAACTCCTCACCATCGGTGATTTCAGTAATGGCAAAGAAGA
CCGGCCATTATCGGAAAGAGCAAAAATCAACGTCAATAAAAATAACTTCAACAGCGTACTTTCGGAATTC
AGCCCGGAAATCAGCCTCACGGTACAGAACACGCTGGCCGGTGATAGCGCCGAAGAAAATATTCAGCTCC
GCTTCGCCGATATGAAAGATTTCGAACCGGAGCAGGTGGCCCGCCAGATCCCCCAGCTCCGCGCCATGCT
GGCGATGCGGAATTTATTACGCGACCTCAAATCCAACCTCCTTGATAACGCCACTTTCAGAAAAGAGCTT
GAGAAAATCCTGAAAGACCCGGCGCTGACGCAGGAATTACGCGACGAAATGAGCGCGCTGGCCCCGAAAT
AA