SecReT6
Protein ID: 375260547
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18780
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4057324..4058859 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG8W9B5
KEGG IDkox:KOX_18780
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-172, Aligned region: 85..507
Protein Sequence: 511 a.a.     [Download]
>gi|375260547|ref|YP_005019717.1| type VI secretion protein EvpB [Klebsiella oxytoca KCTC 1686]
MSVNTETAPAQGQTAVLEKESVYASLFDKINLTPASRLGDINDFLDDAALSDAPAGERLTAAMQVFMDCI
RQSRKTVEKLDKTLIDHHIAELDYQISRQLDAVMHHPEFQKVESLWRGLKQLVDSTDYRQNVKTEILDVS
KDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISGVSAAAHMPFI
GAVGPAFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRSFN
YVEQVKGPDHEKYLWTSASFSFASNMVKSFINNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEV
MIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYLK
LVQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAVPH
FQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1536 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4057324-4058859 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGTCTGTAAATACTGAAACCGCCCCCGCGCAGGGGCAGACCGCTGTACTGGAAAAAGAGAGCGTTTACG
CTTCCCTGTTTGACAAAATCAACCTGACCCCGGCGTCCCGCCTGGGCGATATTAACGACTTTCTGGATGA
TGCCGCGCTGTCCGACGCCCCGGCGGGCGAACGACTGACGGCGGCGATGCAGGTGTTTATGGACTGCATC
CGTCAGTCCAGAAAGACCGTGGAGAAGCTCGACAAGACCCTGATTGACCACCATATCGCTGAACTGGACT
ATCAAATCAGCCGCCAGCTGGACGCGGTGATGCACCATCCTGAGTTCCAGAAGGTGGAATCCCTGTGGCG
CGGCCTGAAGCAGCTGGTGGACAGCACCGACTACCGCCAGAACGTCAAAACCGAAATTCTGGATGTCTCC
AAAGACGATCTGCGCCAGGACTTCGAAGACGCGCCGGAGCTGATTCAGAGCGGTCTCTACTGGCACACCT
ACACCGCCGAGTACGACACCCCGGGCGGCGAGCCGATTGGCTCGGTGATCTCCGCGTATGAGTTCGACGC
CAGCCCGCAGGACGTGGCGCTGCTGCGCAACATCTCCGGCGTCTCCGCCGCGGCGCATATGCCGTTTATC
GGCGCCGTCGGCCCGGCCTTCTTTCTGAAAGAGTCCATGGAAGAGGTTGCCGCCATCAAGGATATCGGCA
ACTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTTCGCGACACCGACGACGCGCGCTATATCGG
CCTGGTGATGCCGCGCGTGCTGGGCCGCCTGCCGTATGGTCCGGACACCGTGCCGGTGCGCAGCTTCAAC
TACGTCGAGCAGGTGAAAGGCCCGGACCATGAGAAATACCTGTGGACCAGCGCCTCGTTCTCCTTCGCGT
CCAATATGGTGAAAAGCTTTATTAATAACGGCTGGTGCGTGCAGATCCGTGGCCCGCAGGCGGGCGGAGC
GGTGAAAGATCTGCCGATCCACCTCTACGATCTGGGCACAGGCAACCAGGTGAAGATCCCGTCGGAGGTG
ATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAGCCTCGGCTTTATCCCGCTGTCGTACTACAAAAACC
GCGACTATGCCTGCTTCTTCTCGGCCAACTCCGCCCAGAAGCCGGCGCTGTACGACACCGCCGACGCCAC
CGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGTATTGCGCACTACCTGAAG
CTCGTTCAGCGTGAAAACATCGGCACCACCAAGGATCGCCGCCTGCTGGAGCTGGAGCTCAACACCTGGG
TGCGCGGTCTGGTGACGGAGATGACCGACCCGGGCGACGAGCTGCAGGCCTCACACCCGCTGCGCGACGC
GAAGGTGGTGGTGGAAGATATCGAGGACAATCCGGGCTTCTTCCGGGTGAAGCTGTACGCGGTGCCGCAC
TTCCAGGTGGAAGGGATGGACGTGAACCTGTCTCTGGTTTCTCAGATGCCGAAAGCGAAAGCGTAA