SecReT6
Protein ID: 375260548
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18785
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4058873..4060216 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8W9B6
KEGG IDkox:KOX_18785
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-132, Aligned region: 18..444
Protein Sequence: 447 a.a.     [Download]
>gi|375260548|ref|YP_005019718.1| hypothetical protein KOX_18785 [Klebsiella oxytoca KCTC 1686]
MKTVRPLWGRGQMVSPQHFQQEAAQAAWHTECVARLGAIHPWGVARTAFDAALLKQGKLKADHLCVRFAD
GTLTDSDNADALPPVMTLPETESHELTVVLALPHEYENGGNCLQPEQKAERPVRWRLAWREVRNRYGDDS
RQIAVMQPELTLRTDDNDNGNYQTVAVARLKRDSQGNWSQDASFIPPLLNVQASRWLTEQTEYLTGQLRA
RLQRLMSMRRESNERMADFAVADVSLFWLLNALNSAEPVLSHLVRYPQVHPERLYQALAGLAGSLLTFSL
DHTTADIPAYRHEQLTAVFPPLFDLLGVLLEASLPSRVVAIDMVRDERRKRWHARLHDPRLREEADFYLS
VRSPLPVAQLLEQFPLQCKAGSPDEVDRVVNGSQPGIPLRAMSHVPAAIPLRLENQYFTLDMAHPAARAM
LLEGSCVFYVPGLLGDPELELFAVLRS
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4058873-4060216 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAAAACAGTACGACCGCTGTGGGGGCGGGGCCAGATGGTTTCCCCTCAACATTTTCAGCAGGAGGCCG
CGCAAGCGGCCTGGCACACAGAGTGTGTCGCCCGACTGGGAGCAATACATCCCTGGGGGGTTGCGCGGAC
GGCTTTTGACGCCGCGCTGCTGAAACAGGGGAAACTGAAGGCCGACCACCTGTGCGTGCGTTTCGCTGAC
GGAACGCTCACTGATAGCGATAACGCCGATGCGTTGCCGCCCGTGATGACCTTACCGGAAACAGAAAGCC
ACGAACTGACGGTGGTTTTGGCGCTGCCCCATGAGTATGAAAACGGCGGCAACTGCCTGCAACCGGAGCA
GAAAGCGGAGCGTCCTGTGCGCTGGCGTCTGGCCTGGCGGGAGGTGCGTAACCGCTATGGGGATGACAGC
CGCCAGATTGCGGTAATGCAGCCGGAGCTGACGCTGCGTACAGACGATAACGACAACGGCAATTACCAGA
CCGTCGCCGTGGCCCGTCTTAAGCGCGACAGCCAGGGAAACTGGTCGCAGGACGCGTCGTTTATCCCGCC
GCTGCTGAACGTGCAGGCCAGCCGCTGGCTAACGGAGCAGACCGAATATCTGACGGGTCAGCTACGCGCG
CGCCTGCAGCGCCTGATGTCTATGCGCCGGGAGAGCAACGAACGGATGGCCGACTTCGCGGTGGCGGACG
TGTCGCTGTTCTGGCTGCTGAATGCGCTCAACAGCGCTGAGCCGGTGCTCAGCCATTTGGTGCGCTATCC
GCAGGTACACCCGGAGCGGCTTTATCAGGCGCTGGCCGGTCTTGCAGGCAGCCTGCTGACGTTTTCTCTT
GATCACACCACCGCCGATATTCCGGCCTATCGTCATGAGCAGCTAACGGCGGTCTTCCCGCCGTTGTTTG
ACCTGCTGGGTGTGCTGCTGGAAGCCAGCCTGCCGTCGCGGGTCGTGGCGATTGACATGGTCCGCGATGA
GCGGCGCAAGCGCTGGCACGCCCGTCTCCACGATCCGAGACTGCGTGAAGAGGCGGATTTTTATCTCTCG
GTACGCTCGCCGCTGCCGGTAGCGCAACTGCTGGAGCAGTTTCCGCTTCAGTGCAAAGCGGGTAGCCCGG
ATGAAGTCGACAGGGTGGTCAATGGTTCCCAGCCCGGCATTCCTTTGCGCGCGATGAGCCACGTCCCTGC
GGCTATCCCGCTGCGCCTGGAAAACCAGTATTTCACCCTTGATATGGCCCATCCGGCGGCGCGGGCGATG
CTGCTGGAAGGCAGTTGTGTCTTTTACGTCCCCGGTCTGCTGGGCGATCCGGAACTTGAACTGTTTGCGG
TGCTGCGCTCATGA