SecReT6
Protein ID: 375260549
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18790
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4060213..4060878 [+]
Producthypothetical protein
NoteTssL
UniProt IDG8W9B7
KEGG IDkox:KOX_18790
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.20E-40, Aligned region: 7..208
Protein Sequence: 221 a.a.     [Download]
>gi|375260549|ref|YP_005019719.1| hypothetical protein KOX_18790 [Klebsiella oxytoca KCTC 1686]
MKQDINIDALMADAWLTVTELRFGARLADGEGDRLWRHCVDHIEQVMAKLEAADVSEASRRHILYAWCAL
LDETAKGREGEDDACIVWYDRPLQAKYFGALDAGDALYERMRQVLREPAPDMAVLTCFHRVLMLGFKGCY
ALNEPARDQLVRVLTERVPPFETDQSRPVLAGISGRSGLADGLRRWPVCIGLSLVAIAALWWGLNHWLDS
LIATLLPGAGK
 
Nucleotide Sequence: 666 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4060213-4060878 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAAACAGGACATAAATATCGACGCCCTGATGGCGGACGCGTGGCTGACGGTGACAGAACTGCGGTTCG
GCGCAAGACTGGCCGACGGGGAGGGCGACCGCCTGTGGCGACATTGTGTAGATCATATTGAACAGGTGAT
GGCGAAGCTCGAGGCTGCGGACGTCAGCGAGGCGAGCCGTCGGCATATTCTCTACGCCTGGTGTGCGCTG
CTGGATGAGACCGCCAAAGGGCGCGAAGGCGAGGATGATGCCTGCATCGTCTGGTATGACCGTCCGCTGC
AGGCGAAATACTTTGGTGCTCTGGACGCCGGAGACGCGTTGTATGAACGGATGCGACAGGTTCTGCGCGA
GCCCGCGCCGGATATGGCGGTGCTGACCTGTTTCCACCGGGTGCTGATGCTCGGCTTTAAAGGGTGTTAT
GCCCTGAATGAACCGGCTCGTGACCAGCTTGTTCGGGTACTGACCGAGCGCGTGCCGCCGTTTGAAACGG
ACCAGAGCCGTCCCGTACTGGCGGGTATCTCCGGGCGCAGCGGCCTGGCGGACGGGTTACGTCGCTGGCC
GGTTTGCATCGGGCTGTCGCTGGTAGCGATCGCCGCGCTGTGGTGGGGTCTGAACCACTGGCTTGATTCC
CTGATTGCAACCCTGCTGCCGGGGGCCGGGAAATGA