SecReT6
Protein ID: 375260550
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18795
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4060875..4062563 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDG8W9B8, G8W9B8
KEGG IDkox:KOX_18795
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.90E-16, Aligned region: 148..158
OmpA [PF00691], Evalue: 5.90E-16, Aligned region: 438..533
Protein Sequence: 562 a.a.     [Download]
>gi|375260550|ref|YP_005019720.1| OmpA/MotB domain-containing protein [Klebsiella oxytoca KCTC 1686]
MNVRYLRLLWLWGGILALLLCLLFLPLASGGRILAAALILAAVIAGLIFAGRRREDPLVDNAWLDEIPDA
PYRLPVVLVCGDIAGWPESGPVYRTARGCWLNVPTAELQQTVRILLWKRPDLVSQLAVMVSVCPQLHRDE
AALAAGLYELRWQLSQVRSDCRRAVPLLLNSKVVGASVPQPLWQTAQAGEAMQVWLADDVPCSTGTWLAQ
KDGTDRLAAQVRMNTLVRLTEQTMMAALTAASDDMPPADPAMVVYHMTPSGAPVLADSLWQRWLSQHTAL
NSLPGWQPEPSSADVTLPNFILPLLPLGAGVTPLSRTLRRAFCLFTLAAIIALCASAWNNRQLLQRVGFD
IQHYAQIAMDDYAPKARAVQILRGDALQLDRWARHGEPLEMGLGLYHGEHLRMPVLDAIRSYVPPPPPLK
PAEKTAPKIIRLDSMSLFDTGRWVLKPGSTKLLVNSLVGIKAKPGWLIVVAGHTDSTGDDKSNQILSLKR
AESVRDWMRDTGDVPESCFAVQGYGESRPVAPNDTAEGRALNRRVEISLVPQANACQPPGMTPAPSQDDG
AF
 
Nucleotide Sequence: 1689 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4060875-4062563 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAACGTGCGCTATTTGCGCCTGTTATGGCTCTGGGGCGGGATCCTGGCGCTGCTGCTCTGCCTGCTGT
TTCTGCCGCTGGCCTCCGGCGGACGGATTCTGGCCGCTGCGCTGATACTGGCCGCCGTTATCGCCGGGCT
GATTTTCGCCGGGCGCAGGCGGGAAGATCCGCTGGTAGATAACGCCTGGCTGGATGAGATACCGGACGCG
CCGTATCGCCTGCCGGTGGTGCTGGTCTGCGGTGATATCGCCGGGTGGCCGGAGAGCGGGCCAGTTTACC
GCACGGCACGGGGCTGCTGGTTAAACGTCCCGACGGCTGAACTGCAGCAGACGGTACGTATTCTTCTGTG
GAAACGCCCGGACCTCGTATCGCAGCTGGCGGTGATGGTCAGCGTCTGTCCGCAGCTGCATCGTGATGAG
GCGGCGCTGGCGGCCGGGCTTTATGAGCTGCGCTGGCAGCTGAGCCAGGTGCGGAGCGATTGCCGCCGGG
CGGTGCCTTTACTGTTGAACAGTAAGGTGGTGGGGGCGTCTGTTCCACAACCGCTGTGGCAGACAGCGCA
GGCCGGGGAGGCCATGCAGGTATGGCTGGCGGACGATGTGCCGTGCAGCACCGGGACATGGCTGGCGCAA
AAGGACGGGACGGACCGCCTGGCTGCGCAGGTGAGGATGAATACGCTGGTTCGCCTGACTGAACAAACAA
TGATGGCCGCGCTGACGGCGGCGTCGGACGATATGCCTCCGGCGGACCCGGCGATGGTGGTATATCACAT
GACGCCTTCGGGGGCGCCGGTTCTGGCTGATAGCCTGTGGCAGCGCTGGTTGTCTCAACATACTGCCCTG
AATTCGCTGCCCGGCTGGCAGCCCGAACCCTCATCAGCGGATGTCACGCTGCCGAATTTTATTCTGCCGC
TGTTGCCACTGGGCGCCGGCGTGACGCCGCTCAGCAGAACTTTACGGCGGGCATTCTGCCTGTTCACCCT
TGCCGCCATCATCGCACTGTGCGCCAGCGCGTGGAACAACCGCCAGCTGCTGCAGCGGGTGGGGTTCGAT
ATTCAGCATTACGCGCAGATTGCGATGGATGACTACGCCCCGAAAGCCCGCGCCGTGCAGATCCTGCGCG
GGGATGCGCTGCAGCTGGATCGGTGGGCGCGCCACGGTGAACCGCTGGAAATGGGGCTCGGCCTGTATCA
CGGGGAGCATTTGCGCATGCCGGTGCTTGACGCCATTCGTTCCTATGTCCCGCCGCCTCCGCCACTGAAG
CCTGCCGAGAAAACCGCGCCGAAAATCATCCGCCTCGACAGCATGTCGCTGTTCGACACCGGCAGGTGGG
TGCTGAAGCCCGGCTCGACAAAGCTGCTGGTGAACTCGCTGGTCGGCATTAAAGCGAAGCCCGGCTGGCT
GATTGTGGTGGCGGGCCATACCGACAGCACCGGCGACGATAAATCCAACCAGATACTTTCGCTTAAGCGT
GCCGAATCGGTGCGCGACTGGATGCGCGACACCGGCGACGTGCCGGAGAGCTGTTTTGCGGTGCAGGGCT
ACGGCGAGAGCCGACCCGTTGCCCCCAACGACACGGCCGAAGGCCGGGCGCTGAACCGCCGTGTCGAAAT
CAGTCTGGTGCCGCAGGCGAATGCCTGCCAGCCACCGGGCATGACCCCCGCGCCATCGCAGGATGATGGC
GCTTTTTAA