SecReT6
Protein ID: 375260552
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18805
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4063446..4066088 [+]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDG8W9C0
KEGG IDkox:KOX_18805
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-41, Aligned region: 234..253
AAA_2 [PF07724], Evalue: 2.20E-41, Aligned region: 608..773
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 236..348
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 613..740
AAA [PF00004], Evalue: 4.70E-20, Aligned region: 761..778
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 236..256
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 310..366
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 612..731
ClpB_D2-small [PF10431], Evalue: 3.40E-14, Aligned region: 381..404
ClpB_D2-small [PF10431], Evalue: 3.40E-14, Aligned region: 582..601
ClpB_D2-small [PF10431], Evalue: 3.40E-14, Aligned region: 779..853
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 140..148
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 281..314
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 454..512
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 581..649
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 676..706
AAA_16 [PF13191], Evalue: 6.70E-14, Aligned region: 751..803
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 235..321
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 365..396
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 609..652
AAA_25 [PF13481], Evalue: 3.00E-09, Aligned region: 236..311
AAA_25 [PF13481], Evalue: 3.00E-09, Aligned region: 608..641
AAA_19 [PF13245], Evalue: 6.70E-09, Aligned region: 233..257
AAA_19 [PF13245], Evalue: 6.70E-09, Aligned region: 608..635
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 230..295
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 612..632
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 214..251
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 288..386
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 605..631
AAA_17 [PF13207], Evalue: 4.10E-06, Aligned region: 236..301
AAA_17 [PF13207], Evalue: 4.10E-06, Aligned region: 611..648
AAA_17 [PF13207], Evalue: 4.10E-06, Aligned region: 794..812
Sigma54_activat [PF00158], Evalue: 1.00E-05, Aligned region: 219..250
Sigma54_activat [PF00158], Evalue: 1.00E-05, Aligned region: 611..730
Zeta_toxin [PF06414], Evalue: 1.30E-05, Aligned region: 230..260
Zeta_toxin [PF06414], Evalue: 1.30E-05, Aligned region: 602..652
NACHT [PF05729], Evalue: 3.10E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 3.10E-05, Aligned region: 612..636
Clp_N [PF02861], Evalue: 4.80E-05, Aligned region: 22..61
Clp_N [PF02861], Evalue: 4.80E-05, Aligned region: 105..123
Clp_N [PF02861], Evalue: 4.80E-05, Aligned region: 857..870
AAA_14 [PF13173], Evalue: 6.00E-05, Aligned region: 236..339
AAA_14 [PF13173], Evalue: 6.00E-05, Aligned region: 610..694
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 236..256
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 613..642
AAA_23 [PF13476], Evalue: 0.00021, Aligned region: 236..252
AAA_23 [PF13476], Evalue: 0.00021, Aligned region: 447..533
AAA_23 [PF13476], Evalue: 0.00021, Aligned region: 609..636
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 87..94
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 230..252
AAA_29 [PF13555], Evalue: 0.00036, Aligned region: 608..635
T2SE [PF00437], Evalue: 0.00093, Aligned region: 160..252
T2SE [PF00437], Evalue: 0.00093, Aligned region: 608..690
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 237..258
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 613..634
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 710..731
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 236..255
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 392..436
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 612..632
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 232..257
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 526..540
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 609..638
DUF2075 [PF09848], Evalue: 0.0037, Aligned region: 238..338
DUF2075 [PF09848], Evalue: 0.0037, Aligned region: 389..406
DUF2075 [PF09848], Evalue: 0.0037, Aligned region: 611..634
AAA_33 [PF13671], Evalue: 0.0062, Aligned region: 236..255
AAA_33 [PF13671], Evalue: 0.0062, Aligned region: 611..633
TIP49 [PF06068], Evalue: 0.0065, Aligned region: 236..257
TIP49 [PF06068], Evalue: 0.0065, Aligned region: 287..316
TIP49 [PF06068], Evalue: 0.0065, Aligned region: 580..633
Protein Sequence: 880 a.a.     [Download]
>gi|375260552|ref|YP_005019722.1| type VI secretion ATPase, ClpV1 family protein [Klebsiella oxytoca KCTC 1686]
MENPAILLRRLNPYCARAMEGAATLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDAIWQDLL
TFMDKLPRSVRGRPQLSDAIQTLMQEAWLSASLAGEEHIRSIHLLMALVDKQSLVRCDGLWPLLTLAQSQ
LARLRPLLDAQSEERPEVQQEAELAQGDEVAFVGRPVNAGVKEGDLNPALQNALDKFTLDVTARARDGKI
DPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLAIRIAEGNVPDALKPVSVRTLDLGLLQA
GAGVKGEFEQRLKNIIDAVQQSPLPVLLFIDEAHTLIGAGNQAGGADAANLLKPALARGELRTIAATTWS
EYKQYFERDAALERRFQMIKVDEPDDDTACLMLRGLKSRYAEHHGVHITDEAVRAAVTLSRRYLTGRQLP
DKAVDLLDTASARIRMSLDTVPAPLTRLKAQLTGLAMEKQALLEDIAAGNHTHGERLAAIEQDEVRIILQ
LDELETQYGQELKLTENLLACRADISRQAEIADLQNQLSAVQQGNPLLGLDVDARTVATVIADWTGVPLS
SLMKDEQTELLSLEQQLGRRVVGQDAALNAIAQRLRASKTGLTSENGPQGVFLLTGPSGTGKTETALALA
DALFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNL
FYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHIMQMLDERPEAMESDLHELLRPLLRDHFQPALLAR
FQTVIYRPLTRDAMRTIVGMKLSQVSKRLSRHYGMTTAISDSLYDALTDACLLPDTGARNVDSLLNQQIL
PALSLQLLSHQAAGQKPQHLMLGRDEEGGIVMEFGAGAGV
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4063446-4066088 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGAAAATCCCGCCATTTTGTTACGCCGACTTAACCCTTACTGCGCCCGTGCGATGGAAGGCGCTGCCA
CCCTGTGCCAGACCCGGGCGCACGCGGAAATCCTGCCTGAGCACTGGCTGCTGAAACTGCTGGAGCAGGG
CGAGGGCGACCTGACGGTGCTGGCGCGGCGCTACGAATGGGATATGGACGCGATATGGCAGGATTTGCTG
ACCTTTATGGATAAGCTCCCCCGTTCGGTGCGCGGCCGCCCGCAGCTTTCAGACGCTATTCAGACTCTGA
TGCAGGAGGCATGGCTAAGCGCTTCGCTGGCCGGGGAGGAGCATATCCGTAGTATCCACCTGCTGATGGC
GCTGGTGGATAAACAGAGTCTGGTGCGCTGCGACGGCCTGTGGCCGCTGCTGACCCTGGCGCAGAGCCAG
CTGGCGCGCCTGCGTCCGCTACTGGACGCGCAGTCCGAGGAACGCCCGGAGGTGCAGCAGGAAGCAGAGC
TGGCGCAGGGCGACGAGGTGGCGTTTGTCGGCCGTCCGGTTAATGCGGGCGTAAAAGAAGGGGATCTGAA
TCCGGCCCTGCAGAATGCGCTGGATAAGTTCACCCTCGACGTGACCGCCCGCGCCCGGGACGGCAAAATC
GACCCGGTGTTCGGCCGTGATAATGAAATCCGCCAGATGGTGGACATTCTTTCCCGACGCCGCAAGAACA
ACCCGATACTGGTGGGCGAGCCGGGCGTCGGCAAGACCGCGCTGGTGGAAGGTCTGGCGATCAGAATCGC
CGAAGGCAATGTCCCGGACGCGCTGAAACCGGTAAGCGTGCGCACCCTTGACCTCGGCCTGCTGCAGGCC
GGAGCGGGGGTGAAGGGAGAATTCGAGCAGCGGCTGAAAAACATTATCGACGCGGTGCAGCAGTCGCCGC
TGCCTGTGCTTCTGTTTATTGATGAGGCCCACACCCTTATCGGCGCGGGTAACCAGGCGGGCGGCGCCGA
TGCGGCTAACCTGCTGAAACCGGCCCTTGCCCGGGGCGAACTCAGAACCATCGCCGCCACAACCTGGAGC
GAGTACAAACAGTATTTTGAGCGCGATGCGGCGCTGGAGCGGCGCTTCCAGATGATCAAAGTCGATGAGC
CGGACGACGACACCGCCTGCCTGATGCTCAGGGGCCTGAAGTCCCGCTACGCGGAGCATCACGGGGTGCA
CATCACCGATGAGGCGGTGCGCGCCGCCGTCACCCTCTCCAGACGCTATCTGACCGGACGCCAGCTGCCG
GACAAGGCGGTGGATTTACTCGACACCGCCTCCGCCCGCATCCGCATGAGCCTGGATACGGTGCCGGCAC
CGCTGACCCGCCTGAAGGCGCAGCTCACCGGCCTGGCGATGGAAAAGCAGGCGCTGCTGGAAGATATCGC
GGCGGGCAACCATACCCACGGCGAACGCCTGGCGGCCATCGAACAGGACGAAGTCCGTATTATCCTGCAG
CTCGACGAGCTGGAAACGCAGTACGGCCAGGAGCTGAAGCTCACGGAAAACCTGCTCGCCTGCCGCGCCG
ATATCTCCCGCCAGGCGGAAATCGCGGACCTGCAAAACCAGCTTAGTGCCGTGCAGCAGGGGAACCCGCT
GCTGGGGCTGGACGTGGACGCGCGCACCGTTGCCACGGTCATCGCCGACTGGACCGGCGTGCCGCTCTCG
TCTCTGATGAAGGATGAGCAGACGGAGCTGCTGAGCCTGGAACAGCAGCTCGGTAGACGCGTGGTGGGCC
AGGACGCGGCGCTGAACGCCATCGCGCAGCGTCTCCGTGCCAGCAAAACCGGGCTGACGTCGGAGAACGG
CCCGCAGGGCGTGTTCCTGCTGACCGGGCCGAGCGGCACCGGCAAGACTGAAACCGCGCTTGCCCTTGCT
GACGCGCTGTTCGGCGGTGAGAAATCCTTAATCACTATCAACCTCTCCGAATACCAGGAGCCGCATACCG
TCTCCCAGTTGAAAGGCTCTCCTCCGGGGTACGTCGGCTACGGCCAGGGCGGGATCCTCACTGAAGCGGT
CAGAAAGCGTCCGTACAGCGTGGTGCTGCTGGACGAAGTGGAGAAGGCCCATCGGGACGTGATGAACCTG
TTCTACCAGGTGTTTGACCGGGGTTTTATGCGCGACGGCGAGGGGCGGGAGATCGACTTTCGCAACACGG
TTATTCTGATGACCTCCAACCTCGGCAGCGACCACATCATGCAGATGCTGGACGAACGGCCGGAGGCCAT
GGAATCCGACCTGCATGAACTGCTGCGTCCGCTGCTGCGCGACCACTTCCAGCCCGCGCTGCTGGCGCGC
TTCCAGACGGTGATCTACCGCCCGCTCACGCGGGACGCGATGCGCACGATTGTCGGAATGAAGCTCAGCC
AGGTGAGCAAACGCCTCAGTCGCCACTACGGCATGACCACTGCCATCAGCGACAGCCTGTACGACGCTCT
GACGGATGCCTGCCTGCTGCCGGATACCGGGGCGCGCAACGTGGACAGCCTGCTCAATCAGCAGATACTG
CCGGCGCTGAGCCTGCAGCTGTTAAGCCATCAGGCGGCGGGGCAGAAGCCGCAGCACCTGATGCTGGGCC
GGGATGAAGAGGGGGGGATTGTGATGGAGTTTGGCGCAGGGGCGGGCGTATGA