SecReT6
Protein ID: 375260553
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18810
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4066085..4068580 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8W9C1
KEGG IDkox:KOX_18810
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.70E-63, Aligned region: 33..353
Phage_GPD [PF05954], Evalue: 4.70E-63, Aligned region: 581..597
DUF2345 [PF10106], Evalue: 1.10E-37, Aligned region: 577..601
DUF2345 [PF10106], Evalue: 1.10E-37, Aligned region: 607..758
T6SS_Vgr [PF13296], Evalue: 4.20E-34, Aligned region: 489..594
T6SS_Vgr [PF13296], Evalue: 4.20E-34, Aligned region: 632..665
Phage_base_V [PF04717], Evalue: 3.40E-18, Aligned region: 344..356
Phage_base_V [PF04717], Evalue: 3.40E-18, Aligned region: 389..483
Fil_haemagg_2 [PF13332], Evalue: 0.002, Aligned region: 544..592
Fil_haemagg_2 [PF13332], Evalue: 0.002, Aligned region: 629..741
Protein Sequence: 831 a.a.     [Download]
>gi|375260553|ref|YP_005019723.1| hypothetical protein KOX_18810 [Klebsiella oxytoca KCTC 1686]
MSEIKSLLFSHSHHLLTVRGCSALLDVLSFEGEEALSEPFRYVIEFTSADKTITPQQMLMQDATFTLQAP
ADQGFGINIQQPVRTIQGVVTAFERLSASRDETHYCLTLQPRLALLSRSHQNRIYQDMSVPDIVEHILRT
RHAMRGEDFVFTLAQAYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLNIDVVEFYDDQRHYEQG
LVLPSVPPSGQHDGGTESVWALKSQHNVVQQSVFTRDYNYRNAPEEMSQSADVTSGDVTTYGEAYHWADN
YLAPGSDGLRNPEPESGAFYARLRHERYLNDQTRLSGRTSSAALAPGRELKVTGGAEVTEVFCQGVVITG
IHSRARRDRSYEVAFTAIPFSENYGFRPQPGDRPVMAGTLPARVTSTKTNDIYGHIDRDGRYKVNLLFDR
DHWSPGEESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEQGDPDRPYIAGVLHDSAHPDPVTIRNYKRN
VLRTPANNKIRLDDARGKEHIKVSTEYGGKSQLNLGHLVDSEKQPRGEGFELRTDSYGTIRAGKGIFITA
DAQSKAQGQQLAMEPALSRLSAALVEMQSLAASAQQAQALAADVGRQQTLLQQKIEQLQKEVLLGTAPQG
VALASGDDMLLSAQKNLTLIAGQQLDMGAQKDFTLAAGKQLSLWSQNGAKWFASRGDIDIQAQGGHITTW
STQDTHISSGKKLVITAQDELTLICGGGYIKIKGGNVEIGGPGKLLIKNIGIKKAGSGSMQGVMKSFESG
SFDEKFVIRNSLTKEPLANKAYSITMPDGRIVSGVTDLNGSTSLNASDVIDDMTITLIKGR
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4066085-4068580 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGCGAGATAAAATCCCTGCTGTTCAGCCACAGCCACCATCTGTTAACGGTGCGCGGCTGCAGCGCTC
TTCTGGACGTGCTGAGCTTTGAAGGTGAGGAGGCCCTGAGCGAACCGTTCAGATACGTGATTGAGTTCAC
CAGCGCCGACAAAACCATCACGCCGCAGCAGATGCTGATGCAGGACGCGACCTTCACCCTGCAGGCGCCG
GCGGACCAGGGTTTCGGGATTAACATTCAGCAGCCGGTGCGCACGATTCAGGGCGTGGTGACGGCGTTTG
AGCGCCTTTCCGCATCCCGCGACGAAACGCACTATTGCCTGACCCTGCAGCCTCGTCTGGCGCTGCTCTC
CCGGAGCCACCAGAACCGGATTTACCAGGATATGTCGGTGCCGGATATCGTGGAGCATATCCTGCGTACC
CGCCACGCCATGCGCGGGGAGGACTTTGTCTTCACCCTGGCACAGGCGTATCCGCGTCGCGAGCAGGTGA
TGCAGTACGGCGAGGACGACCTGCGCTTTATCACCCGCCTGCTGGGCGAGGTCGGTATCTGGTTCCGCTT
CACCGCCGACACCCGGCTGAACATTGACGTGGTGGAGTTTTACGATGACCAGCGGCACTACGAGCAGGGA
CTGGTTCTGCCGTCGGTGCCGCCCTCCGGCCAGCACGACGGCGGTACCGAGTCGGTGTGGGCGCTGAAAA
GCCAGCATAACGTGGTGCAGCAGTCGGTGTTCACCCGGGACTACAACTACCGCAACGCGCCGGAGGAGAT
GAGCCAGAGCGCGGACGTGACGTCCGGCGACGTCACCACCTACGGCGAGGCGTATCACTGGGCGGATAAC
TACCTGGCGCCGGGCAGCGACGGCCTGCGCAACCCGGAGCCGGAGAGCGGGGCGTTTTATGCCCGTCTGC
GCCACGAGCGCTACCTGAACGACCAGACCCGGCTGAGCGGCAGGACCAGCAGCGCGGCGCTGGCGCCGGG
CCGGGAGCTGAAGGTCACCGGAGGCGCTGAGGTGACGGAGGTTTTCTGCCAGGGCGTGGTGATTACCGGC
ATCCACAGCCGCGCCCGTCGCGACCGCAGCTATGAGGTGGCGTTTACGGCCATCCCGTTCTCGGAAAATT
ACGGCTTCCGTCCGCAACCGGGCGACAGGCCGGTCATGGCCGGCACGCTGCCGGCGCGGGTAACCAGTAC
GAAAACCAACGATATCTACGGCCATATCGACCGCGACGGCCGTTATAAGGTCAACCTGCTGTTCGACCGC
GACCACTGGTCGCCGGGGGAAGAGAGTCTGTGGGTACGTCAGGCGCGCCCCTATGCCGGGGACACATACG
GCCTGCACCTGCCGCTGCTGGCGGGGACGGAAGTGGCCATCGCTTTTGAGCAGGGGGACCCTGACCGTCC
GTATATTGCCGGAGTCCTGCACGACTCAGCGCACCCGGACCCTGTCACCATCCGGAACTATAAGCGCAAC
GTCCTGCGGACCCCGGCGAACAACAAAATCCGCCTCGACGACGCGCGTGGCAAAGAGCACATCAAGGTCA
GCACGGAGTACGGCGGCAAGAGCCAGCTGAACCTGGGGCATCTGGTGGACAGCGAAAAACAGCCACGCGG
CGAGGGGTTTGAGCTGCGGACGGATAGCTACGGGACTATCCGCGCCGGGAAGGGAATATTCATTACTGCT
GATGCACAATCGAAGGCGCAGGGACAGCAATTGGCGATGGAACCGGCGCTGTCGCGGCTTTCAGCGGCAC
TAGTGGAAATGCAGTCACTGGCTGCCAGCGCACAGCAGGCACAGGCGCTGGCTGCGGATGTTGGACGTCA
GCAGACGTTGCTGCAACAGAAGATAGAGCAGCTTCAGAAGGAAGTACTCCTGGGAACGGCCCCGCAGGGT
GTGGCGCTGGCAAGCGGTGACGATATGCTGCTGTCGGCGCAGAAGAATCTGACGCTGATTGCAGGTCAGC
AGCTGGATATGGGGGCGCAGAAGGACTTCACACTGGCGGCGGGTAAACAACTCAGTCTCTGGAGTCAGAA
TGGGGCGAAGTGGTTTGCGTCGCGGGGGGATATTGATATTCAGGCGCAGGGCGGACATATCACCACTTGG
TCAACGCAGGACACGCATATTTCGAGTGGCAAGAAACTGGTAATAACGGCACAGGATGAACTGACGCTGA
TATGCGGGGGCGGATATATCAAAATCAAAGGTGGGAATGTTGAAATTGGCGGTCCTGGAAAGTTGCTGAT
AAAAAACATCGGTATTAAGAAAGCAGGTTCGGGTAGTATGCAGGGAGTAATGAAGTCGTTTGAGTCGGGA
AGTTTTGATGAGAAGTTTGTCATTCGAAATTCTCTGACCAAAGAACCTTTAGCCAATAAGGCATATTCAA
TAACCATGCCGGATGGAAGGATTGTTTCAGGGGTGACAGATTTAAATGGTTCTACATCATTAAATGCCTC
GGATGTCATTGATGATATGACTATCACTCTTATTAAAGGTAGGTAA