SecReT6
Protein ID: 375260558
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18835
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4070795..4071055 [+]
Producthypothetical protein
NotePAAR
UniProt IDG8W9C6
KEGG IDkox:KOX_18835
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-18, Aligned region: 8..79
Protein Sequence: 86 a.a.     [Download]
>gi|375260558|ref|YP_005019728.1| hypothetical protein KOX_18835 [Klebsiella oxytoca KCTC 1686]
MGKKIVVLGDATSHGGKVVSVSSTFEIEGKNVALLNDSVSCPEHGSNPIVECDMSYEENGRGIVAHGCKS
ACGSVIFASLPDVEIG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4070795-4071055 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGGAAAGAAAATAGTTGTTCTTGGCGATGCTACCTCGCATGGAGGTAAAGTAGTCTCTGTATCATCTA
CTTTTGAAATTGAAGGTAAAAATGTTGCACTGCTGAATGATTCGGTGTCCTGTCCGGAACACGGTTCTAA
TCCGATAGTGGAATGCGATATGAGTTATGAGGAAAACGGTAGGGGAATTGTGGCGCATGGTTGTAAGAGC
GCCTGTGGTTCCGTGATCTTCGCTAGTTTGCCGGATGTGGAGATAGGTTGA