SecReT6
Protein ID: 375260564
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18865
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4078925..4079422 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDG8W9D2
KEGG IDkox:KOX_18865
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.40E-33, Aligned region: 3..155
Protein Sequence: 165 a.a.     [Download]
>gi|375260564|ref|YP_005019734.1| type VI secretion system protein VasD [Klebsiella oxytoca KCTC 1686]
MPLLLTGCGLTQKISDSTLSAVKSVFYKQVNVLHLDVTARAELNTDERENTSLSQPVMVWVYQLSDRKTF
DKRVYQQLVTESEEAAGDERLASRSLVVKPGADVSLDIPMDEKAQFIAVVGLFRAPDMVKNDWKLVLRRD
DLDPDKPRIIEASHNRLTLKPLKDD
 
Nucleotide Sequence: 498 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4078925-4079422 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGCCTTTACTGCTGACAGGCTGTGGCCTGACGCAGAAAATTAGCGACAGCACCTTATCGGCGGTGAAAT
CGGTGTTTTATAAGCAGGTAAACGTCCTGCATCTGGACGTTACCGCCCGGGCGGAACTGAACACCGATGA
GCGGGAGAACACCTCGCTCTCCCAGCCGGTGATGGTGTGGGTCTACCAGCTCAGTGACCGCAAGACGTTC
GATAAACGGGTCTATCAGCAGCTGGTCACGGAAAGCGAGGAGGCCGCCGGAGACGAACGGCTTGCCAGCC
GTAGCCTGGTGGTAAAACCCGGCGCTGACGTCAGCCTGGATATTCCGATGGACGAGAAGGCGCAGTTTAT
CGCGGTGGTGGGGTTATTCCGGGCGCCGGATATGGTGAAGAATGACTGGAAGCTGGTGCTGAGGCGCGAC
GATCTCGATCCCGACAAACCGCGCATTATTGAAGCCAGCCATAACCGCCTGACGCTGAAACCCCTGAAGG
ATGACTGA