SecReT6
Protein ID: 375260565
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18870
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4079424..4079879 [+]
Producttype VI secretion system protein
NoteTssE
UniProt IDG8W9D3
KEGG IDkox:KOX_18870
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.30E-14, Aligned region: 31..117
Protein Sequence: 151 a.a.     [Download]
>gi|375260565|ref|YP_005019735.1| type VI secretion system protein [Klebsiella oxytoca KCTC 1686]
MPTRHNAPSLYEMLYGNFTGGLDLHQVSEENQVILSVLDNMQRVLNCRAGTLAHLPDYGLPDMTKILQGM
PGTAHELMGILSAVLLKYEPRLKKIDVVLLEQAIPGELRYAIDAELKGVGLVHYGTEFMPEGRVLIRHLK
QQQYLEVRSSI
 
Nucleotide Sequence: 456 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4079424-4079879 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGCCCACACGCCATAATGCCCCCTCGCTGTATGAAATGCTGTACGGCAACTTTACCGGCGGACTCGACC
TGCATCAGGTCAGTGAGGAAAACCAGGTTATTCTGTCGGTGCTGGATAATATGCAGCGCGTCCTCAACTG
TCGAGCCGGGACGCTGGCGCACCTGCCCGATTACGGCCTGCCGGATATGACTAAAATCCTCCAGGGGATG
CCGGGTACGGCTCATGAGCTGATGGGCATCCTGTCGGCCGTATTGCTTAAATATGAACCGCGGCTGAAGA
AAATTGACGTGGTTCTGCTCGAGCAGGCTATTCCCGGCGAGCTGCGTTACGCCATTGACGCGGAGCTGAA
GGGCGTAGGCCTGGTGCACTACGGCACCGAATTTATGCCCGAGGGCAGGGTGCTTATCCGCCACCTCAAA
CAGCAGCAGTACCTGGAAGTCCGCTCCTCTATCTAG