SecReT6
Protein ID: 375260566
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18875
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4079903..4081237 [+]
Producttype VI secretion system protein VasL
NoteTssA
UniProt IDG8W9D4
KEGG IDkox:KOX_18875
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 92..152
DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 275..287
DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 295..440
ImpA-rel_N [PF06812], Evalue: 4.50E-18, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 4.50E-18, Aligned region: 343..366
Protein Sequence: 444 a.a.     [Download]
>gi|375260566|ref|YP_005019736.1| type VI secretion system protein VasL [Klebsiella oxytoca KCTC 1686]
MTTPSECCLKTGGDPRTLADYARLRDEMNKLTHPARPDVNWRLAEKLCLSLFEHNGVELQTAAWYTLVRM
HLAGLYGMNEGLAILVALVSRQWGNMWPQPTTARIKILSSLSQRLQQAMRTLSLTYIDLSQLYQAEAHLT
ALDDVLQRLELKHAGQLDALSILLHNAAVRLESSENKEETAPQAAAPDPAPSSLPEPTAQVKWVYVAEPA
SRPNADVVTAFPAPAKPWKPFVAGMLTMLALAGAAAGGWRATYPSDSGQMRFPARFSPLPTVLSAEQLQT
LRQQSPSAEPGIKQTQQQLAQLLQLKPDWALSYGTHLAQQALTLWPEQAKPLARQWQQQVSAAALPVENL
SGWHQGMTQLQQLTNRLNALDEQKGRYITVSELKSAVFAITQSFSRTVPAEEQLRQLSAQPRNQPGSAAQ
QNQTEQHLQQLIARYAALKQKTAE
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4079903-4081237 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGACGACTCCTTCTGAATGTTGCCTGAAAACCGGCGGCGACCCGCGTACGCTTGCGGATTACGCGCGCC
TTCGCGATGAAATGAACAAACTAACCCATCCGGCGCGCCCGGATGTCAACTGGCGGCTCGCGGAAAAACT
CTGCCTGTCGCTGTTTGAGCACAACGGCGTGGAGCTACAGACTGCCGCCTGGTATACGCTTGTCCGCATG
CATCTGGCGGGGCTATACGGCATGAATGAAGGGCTGGCGATACTGGTCGCGCTGGTCTCCCGGCAGTGGG
GCAATATGTGGCCGCAGCCGACGACTGCGCGAATCAAAATACTCAGTTCGCTCAGTCAACGGCTGCAGCA
GGCGATGCGCACGCTGTCGCTGACCTATATCGACCTGAGCCAGCTTTACCAGGCAGAAGCGCATCTGACG
GCGCTGGATGACGTACTGCAGCGTCTGGAACTCAAACATGCCGGCCAGCTTGATGCCCTGTCTATCCTGC
TGCACAACGCGGCGGTGCGGCTGGAGAGCAGCGAAAATAAAGAGGAGACCGCGCCGCAAGCGGCCGCGCC
TGATCCTGCCCCTTCCAGCCTCCCTGAACCGACCGCGCAGGTGAAATGGGTCTATGTCGCCGAACCGGCA
TCGCGGCCGAATGCTGACGTTGTGACGGCATTCCCGGCGCCCGCGAAGCCCTGGAAGCCGTTTGTCGCCG
GGATGCTGACTATGCTGGCGCTGGCCGGGGCCGCGGCGGGAGGATGGCGGGCAACGTACCCGTCCGATTC
GGGGCAGATGCGGTTTCCCGCCCGGTTCTCTCCGTTACCCACGGTGCTTTCCGCTGAGCAGTTACAGACG
CTACGACAACAATCCCCCTCGGCGGAGCCGGGGATAAAACAGACTCAGCAGCAGCTGGCGCAGCTTTTAC
AGCTAAAACCGGACTGGGCTTTGAGTTATGGTACTCATCTGGCGCAGCAGGCGCTGACGCTATGGCCAGA
GCAGGCGAAACCGCTGGCGCGGCAATGGCAACAGCAGGTCAGCGCCGCCGCGCTTCCCGTGGAGAATCTC
AGCGGCTGGCACCAGGGAATGACGCAGCTACAGCAGTTGACGAACCGGCTTAACGCACTGGATGAACAGA
AGGGGCGGTATATCACGGTGAGTGAGCTGAAGTCAGCGGTGTTTGCCATAACGCAGTCGTTCAGCCGTAC
CGTTCCGGCGGAAGAGCAGCTGCGACAACTCTCCGCACAGCCGCGCAATCAGCCAGGGTCTGCGGCGCAG
CAGAACCAGACGGAGCAGCATCTGCAACAACTGATTGCCCGCTATGCTGCGCTGAAACAAAAAACGGCGG
AATAA