SecReT6
Protein ID: 375261269
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22400
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4819335..4819805 [-]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDG8WIV1
KEGG IDkox:KOX_22400
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-33, Aligned region: 13..147
Protein Sequence: 156 a.a.     [Download]
>gi|375261269|ref|YP_005020439.1| type VI secretion system protein VasD [Klebsiella oxytoca KCTC 1686]
MTQSITDGTKAVYTAVFYKKIKVLHLDFIAREALNTDSRESNSLSEPVVVRVYQLKDRKNFDKTVYQQLL
KNGDTILKADLLATRDVVIKPGGDANLDMPMEEGAQFVAVAGLFRHPDMVNNTWKQVLRREDLDPDKPRV
LEAGNNHLALQPLKED
 
Nucleotide Sequence: 471 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4819805-4819335 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
GTGACGCAGAGTATTACGGATGGCACCAAAGCGGTGTATACGGCGGTGTTTTATAAGAAGATTAAGGTGC
TGCATCTGGATTTTATAGCCCGTGAAGCACTGAATACGGATTCCCGCGAGAGTAACTCACTGTCTGAGCC
GGTGGTGGTTCGTGTCTACCAGTTGAAAGACCGCAAAAACTTCGACAAAACGGTTTATCAGCAACTCCTC
AAGAACGGCGACACGATCCTGAAAGCCGACCTGCTGGCGACCCGCGACGTGGTGATAAAGCCGGGTGGGG
ATGCGAATCTTGATATGCCAATGGAAGAAGGCGCGCAGTTTGTCGCGGTGGCCGGACTGTTCCGCCATCC
GGATATGGTCAACAATACCTGGAAGCAGGTTCTCAGACGTGAAGATCTCGATCCGGATAAACCCCGTGTT
CTGGAAGCCGGAAATAACCACCTTGCATTACAGCCGCTGAAGGAGGACTAA