SecReT6
Protein ID: 375261270
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22405
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4819858..4820943 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDG8WIV2
KEGG IDkox:KOX_22405
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-75, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|375261270|ref|YP_005020440.1| type VI secretion system protein ImpH [Klebsiella oxytoca KCTC 1686]
MGREAQPPHSRLSPRLAADLHRMNFYRFCQLLEKRNPDRPLMGSTSHPADDPVRFAPHPGMGFPGSELKA
VEYDEDDDSRPPLIRTTFMGMYGVDSPLPTAYLDDITQCREGHEVLQGFLDIFSHRILTQFYRIWRKYSY
PATFEAGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLALLGVLRQPGKTQEGMQALVRLLAPDTTVQV
SPYCLRPVEIGQPLGFYGDDDFLLDGNTPLGEEAMDAGSQLLVALRTDNEQEAQGWKPDGLLYQDFLVML
RVYLGWRFKARITLTTRTRLLAVPPLGEEPFWLGMNGVLGAEEGAFADDLPLTFTTELGYYTGLAPAKPQ
QGNRRAKYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4820943-4819858 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGGAAGAGAAGCACAACCGCCGCATTCCCGGCTGAGCCCGCGGCTGGCAGCCGACCTGCACCGCATGA
ATTTTTATCGCTTCTGCCAGCTTCTGGAGAAGCGTAATCCGGACAGGCCGCTGATGGGGTCAACCAGCCA
CCCTGCTGATGACCCGGTGCGGTTTGCGCCGCATCCGGGGATGGGGTTTCCGGGCAGCGAACTGAAAGCT
GTCGAATATGACGAGGATGATGACAGCAGGCCACCGCTCATCCGCACAACCTTTATGGGGATGTACGGTG
TCGACTCACCCCTGCCGACAGCCTATCTTGATGACATCACTCAGTGCCGTGAAGGGCATGAGGTGCTACA
GGGCTTTCTGGATATCTTCAGCCACCGCATCCTGACGCAGTTTTACCGCATCTGGCGGAAATACTCTTAT
CCGGCCACGTTTGAGGCAGGGGGAACTGACAGCATTTCGCAGTCGCTGCTGGGTCTGGTGGGGCTGGGCA
TACCGGGAACCGCAAACCACATCGCCACACCGGTATCCCGCTTTCTGGCGCTGCTCGGTGTGCTGCGCCA
ACCCGGCAAAACCCAGGAGGGGATGCAGGCGCTGGTGAGACTGCTGGCCCCGGATACTACGGTGCAGGTG
AGTCCGTACTGCCTGCGGCCGGTGGAGATCGGCCAGCCGCTGGGTTTTTACGGCGATGACGATTTTCTGC
TGGACGGCAATACGCCGCTGGGGGAAGAAGCGATGGATGCGGGCAGTCAACTGCTGGTTGCGCTCAGGAC
GGATAACGAACAGGAAGCGCAGGGCTGGAAACCGGATGGTCTGCTGTATCAGGATTTTCTGGTGATGCTG
CGTGTTTATCTCGGCTGGCGTTTTAAGGCCAGGATCACCCTGACCACCCGGACCCGACTGCTGGCCGTCC
CGCCGCTCGGCGAAGAACCTTTCTGGCTCGGCATGAACGGCGTGCTGGGAGCGGAGGAGGGGGCGTTTGC
GGACGATCTCCCGCTGACCTTTACGACAGAACTGGGTTACTACACCGGGCTGGCGCCTGCGAAACCACAA
CAAGGAAATCGACGTGCTAAGTACAAATTTGATTAA