SecReT6
Protein ID: 375261271
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22410
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4820907..4822661 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDG8WIV3
KEGG IDkox:KOX_22410
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-180, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|375261271|ref|YP_005020441.1| type VI secretion protein [Klebsiella oxytoca KCTC 1686]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPQYLRTIPSMSVVEFTPDWREMKEKMRIVKGFEVNSQPIGEKGTRCRYTTTKEISLQPLS
LEHARLSTDPDGRSVINLRFNCSHLADWSRADLSQIPFYFNADAPLACAMHEAFTMNTARLWLRMPGDTD
RKSLDGYFTALGFGDDDGLWPKDSSSFSGYQLLLEYFTFREKFMFTALRGLETVVFPAELAWFEIDVVLA
ERWEHDFSFTEKHLRLNCVPVINLFPLESDPLTLNSLQTEYMLRPMRVQDGHTEIYAVDSVISSSQYTYV
PFSSFRHKGGMMRHEAPEYYYHTRVRRGPSGLYNTWLILGGEAFDNHTVPENESLSLTLTGTNGQLPRRA
LQSTVLDTVMKSTSASVAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLRGTLALYEWTD
SEMNRRRLEAIIDVKHSETGRFEQGYLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4822661-4820907 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTACTACGACGCTGAAATGCGCTATCTGCTGGAAGCCGGCGAAGAATTTG
CCCGCGCTCACCCCGAGCAGGCGGCAATGCTCAATCTCGATAAAGCGGGTGCGCGAGACCCGTACGTGGA
GCGCCTGTTTGAGGGCTTTGCTTTCCTGATGGGTCGTCTTCGCGAGAAACTCGATGACGACCTGCCGGAA
CTGACCGAAGGGCTGGTCAGCCTGCTGTGGCCGCAATACCTGCGCACCATTCCGTCGATGTCGGTGGTGG
AGTTCACGCCCGACTGGCGCGAGATGAAAGAGAAGATGCGTATCGTCAAAGGCTTCGAGGTCAATTCGCA
GCCGATCGGCGAGAAGGGCACGCGCTGCCGGTACACCACCACCAAAGAAATCTCCCTTCAGCCATTGTCG
CTGGAGCATGCCCGTCTGTCGACTGACCCTGACGGGCGTTCGGTCATCAACCTGCGCTTTAACTGCAGCC
ATCTCGCCGACTGGAGTCGTGCCGATCTCAGCCAGATCCCGTTCTACTTCAATGCTGATGCACCGCTGGC
CTGCGCCATGCATGAAGCCTTTACCATGAACACGGCGCGTCTCTGGCTGCGGATGCCGGGTGACACGGAC
AGAAAGTCACTCGACGGGTATTTCACCGCGCTGGGATTCGGTGATGATGACGGGCTGTGGCCGAAGGACA
GCAGCAGCTTTAGCGGCTACCAGTTGCTGCTGGAGTACTTCACCTTCCGCGAAAAATTCATGTTCACGGC
TCTGCGCGGGCTGGAGACCGTAGTCTTTCCGGCTGAGCTCGCGTGGTTCGAAATCGACGTGGTGCTGGCC
GAGCGCTGGGAGCATGACTTCAGCTTTACCGAAAAACATCTGCGCCTGAACTGTGTGCCGGTGATTAACC
TGTTTCCGCTGGAATCTGACCCGCTGACGCTGAATTCACTGCAGACCGAATACATGCTGCGCCCGATGCG
CGTGCAGGATGGCCATACCGAGATTTATGCTGTCGATTCGGTGATATCCTCAAGCCAGTATACCTATGTA
CCGTTCTCCAGTTTCCGCCACAAAGGCGGCATGATGCGCCATGAAGCGCCGGAGTATTACTACCACACCC
GCGTGCGCCGTGGTCCGTCAGGACTGTATAACACGTGGCTTATCCTCGGCGGCGAAGCCTTTGATAATCA
CACGGTGCCGGAAAACGAAAGCCTGTCCCTCACGCTCACCGGTACCAATGGCCAGCTGCCGCGACGCGCA
TTACAAAGCACCGTGCTGGATACGGTGATGAAAAGCACCTCGGCCAGCGTCGCCGTGCGTAACCTGTGTG
CGCCGACGCTGCCCTGCTATCCCCCGGCACAGGACCGTTTTCACTGGCGCGTGCTGAGCCACCTCGGCAG
CGGGTTTCTGTCGATGATGGATAATGCCGACGTGCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAACCGCCGTCGCCTGGAAGCCATTATTGACGTGAAGCACAGTGAGACCGGGCGATTTGAGC
AGGGCTACCTGGTACGCGGCGTGCAGATTGAGGTGACGCTCGACAGCCACGGCTTTGCCGGGCGCGGCGA
CATCTGCCTGTTCGGCGAGATGCTGAGCCGCTTCTTCGCGCTCTACACCGACATCTATCTGTTTAACCGC
CTGATTATTATTCTGCAACCGACCGGAGAGCGCCTGGAATGGGAAGAGAAGCACAACCGCCGCATTCCCG
GCTGA