SecReT6
Protein ID: 375261288
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22495
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4843027..4845369 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8WIX0
KEGG IDkox:KOX_22495
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-65, Aligned region: 34..356
Phage_GPD [PF05954], Evalue: 5.70E-65, Aligned region: 581..608
DUF2345 [PF10106], Evalue: 7.40E-41, Aligned region: 382..402
DUF2345 [PF10106], Evalue: 7.40E-41, Aligned region: 608..756
T6SS_Vgr [PF13296], Evalue: 1.10E-35, Aligned region: 489..593
Phage_base_V [PF04717], Evalue: 6.10E-17, Aligned region: 388..482
SlyX [PF04102], Evalue: 0.0052, Aligned region: 583..622
Protein Sequence: 780 a.a.     [Download]
>gi|375261288|ref|YP_005020458.1| hypothetical protein KOX_22495 [Klebsiella oxytoca KCTC 1686]
MSNNPPLRFSHSHHLLSVKGCDAEPDVLAFEGDEALSKPFRYRIEFTSADHTISKEMMLMKAASLTLQAP
VDQGYGIKIQQPVRVIQGVVTGFERLGTSKDETRYALTLEPRLALLDRSHQNAIYQDMSVPQIVEKILRE
RHNMRGQDFLFSLSKEYPRREQVMQYGENDLHFITRLLGEVGLWFRFTTDTRLNIDVVEFYDSQQGYEKG
LTLPSVPPSGQHSQGVDSVWEMESHHNVVQKQVSIRDYNYRQATEDMNTLVDTTRGDATTYGEAYHWADN
YLTAGNSHDRNPAPESGAFYARIRHERYLNGQTQTRAVTSCPTLSPGMLLKVTGGYEVADVFAQGVVITA
MHSHARRDEDFGIRFDGIPDSPDFSFRPAPGSRPVMAGTVPARVTSTTENDTYGHIDKDGRYRVNMLFDR
DSWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYISGVLHDSAHGDHVTIRNYKRN
VLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSKKQQRGEGFELRTDSWGAIRAQQGIFITA
DAQIKGQGQVLAMDAALGTLNQAQQLAKSLSDAVATAQAELAQIQAQKTLLGSSLKDLQQSALLMSAPDG
IAQVSPQSIQISSGQNFIQTSGENSDFSVFKKFTVAAGEIISLFAKTLGIKMYANKGKVDIQAQGDAMML
TSLKSMTIISKDDEVVIQASKKITLCCGKTAVVIDPSGVNILTPGDVNAKSASLNHLASQSFSPTQPELP
PAASCVESAL
 
Nucleotide Sequence: 2343 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4845369-4843027 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGCAATAATCCTCCGTTAAGATTCAGCCACAGCCATCATCTGCTTTCGGTGAAAGGCTGTGACGCCG
AGCCCGATGTACTGGCGTTTGAAGGCGATGAAGCCCTGAGCAAACCCTTCCGCTACCGTATTGAGTTCAC
CAGCGCTGACCATACCATCAGCAAAGAGATGATGCTGATGAAAGCGGCTTCCCTGACGCTGCAGGCCCCG
GTTGACCAGGGCTACGGCATCAAAATCCAGCAGCCGGTGCGGGTGATTCAGGGAGTGGTGACGGGTTTTG
AACGCCTGGGCACCTCAAAGGACGAAACCCGCTACGCCCTGACGCTTGAGCCACGCCTGGCGCTGCTTGA
CCGTTCGCACCAGAACGCCATTTATCAGGACATGTCGGTCCCACAAATCGTGGAAAAAATTCTGCGCGAG
CGTCACAACATGCGCGGTCAGGATTTTCTGTTCTCGCTCTCAAAAGAGTATCCGCGCCGTGAACAGGTGA
TGCAGTACGGTGAGAACGACCTGCACTTTATCACCCGCCTGCTGGGTGAGGTCGGTCTCTGGTTTCGTTT
TACCACCGACACGCGGCTGAACATCGATGTGGTGGAGTTTTACGACAGCCAGCAGGGGTATGAGAAAGGC
CTGACGCTGCCGTCGGTGCCGCCATCCGGGCAGCATTCGCAGGGTGTGGACTCGGTGTGGGAGATGGAGA
GCCATCATAACGTGGTGCAGAAGCAGGTCAGCATCCGCGATTACAACTACCGCCAGGCCACGGAAGACAT
GAACACCCTCGTTGATACGACCAGGGGAGATGCCACCACTTACGGAGAGGCCTATCACTGGGCGGATAAC
TACCTGACGGCGGGAAACTCCCATGACCGTAATCCGGCACCGGAGTCCGGGGCGTTCTATGCCCGCATTC
GTCACGAACGCTACCTGAATGGCCAGACGCAGACCCGGGCCGTCACCAGCTGCCCGACCCTCTCTCCGGG
GATGCTGCTGAAAGTCACCGGCGGGTACGAAGTGGCAGACGTGTTTGCGCAGGGCGTGGTCATCACGGCG
ATGCACAGCCATGCGCGGCGTGATGAGGACTTTGGCATCAGGTTTGACGGTATCCCGGACAGCCCGGATT
TTAGTTTCCGCCCGGCGCCCGGCAGTCGTCCGGTGATGGCAGGCACCGTACCGGCCCGCGTCACCAGTAC
CACTGAAAATGACACCTACGGGCATATCGATAAGGACGGCCGCTACCGCGTCAACATGCTGTTTGACCGG
GACAGCTGGGAGACCGGGTTCGAGAGCCTGTGGGTTCGTCAGTCCCGGCCGTATGCCGGGGACACTTATG
GTCTGCATCTGCCGCTGCTCGCGGGCACCGAGGTGGCGATTGGTTTTGAGGACGGTAACCCGGACAGACC
GTACATTTCTGGCGTACTTCACGACTCGGCGCACGGTGACCATGTCACTATCCGAAACTACAAACGTAAC
GTCCTGCGCACCCCGGCGAACAACAAAATCCGCCTTGATGACGAGCGCGGGAAAGAGCATATCAAGGTGT
CGACGGAGTACGGCGGCAAGAGCCAGCTGAATCTCGGACATCTGGTCGACAGCAAGAAACAACAGCGCGG
GGAAGGTTTTGAACTCAGGACGGACAGCTGGGGGGCTATTCGTGCACAGCAGGGTATTTTCATCACCGCA
GATGCACAAATCAAAGGTCAGGGACAGGTTCTGGCGATGGATGCGGCGCTGGGGACACTCAATCAGGCGC
AGCAGTTAGCGAAATCACTGAGCGATGCTGTAGCCACTGCACAGGCTGAACTCGCGCAGATCCAGGCGCA
AAAAACATTGCTGGGATCCTCTCTCAAGGATCTGCAGCAGTCCGCGTTGCTGATGAGCGCCCCGGACGGG
ATAGCTCAGGTATCACCGCAAAGCATCCAAATCAGCAGCGGACAGAACTTTATTCAGACCTCCGGCGAGA
ACAGTGACTTTAGCGTCTTCAAAAAATTCACCGTTGCGGCAGGCGAGATCATCAGCCTGTTTGCCAAAAC
GCTGGGCATCAAGATGTATGCCAATAAGGGTAAGGTTGATATTCAGGCACAAGGGGATGCAATGATGCTG
ACCTCCCTGAAAAGCATGACCATCATCAGTAAAGACGATGAGGTGGTGATTCAGGCAAGCAAGAAAATTA
CTTTATGTTGCGGTAAAACCGCTGTGGTCATCGACCCGTCTGGCGTCAATATTCTGACGCCTGGTGATGT
GAATGCCAAATCAGCCAGCCTGAACCATCTGGCATCACAGAGCTTCAGCCCGACACAACCTGAACTGCCA
CCGGCGGCCAGTTGTGTGGAGAGTGCGCTCTGA