SecReT6
Protein ID: 375261290
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22505
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4846018..4846158 [-]
Producthypothetical protein
NoteTssD
UniProt IDG8WIX2
KEGG IDkox:KOX_22505
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.0e-07, Aligned region: 9..30
Protein Sequence: 46 a.a.     [Download]
>gi|375261290|ref|YP_005020460.1| hypothetical protein KOX_22505 [Klebsiella oxytoca KCTC 1686]
MYDIKDPSKEKHNHLERVELRYEKITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 141 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4846158-4846018 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGTACGACATCAAGGATCCTTCTAAAGAGAAGCACAACCATCTTGAGCGCGTAGAACTGCGTTACGAAA
AAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATAGCTGGAACGAACGCGCCACCGCGTA
A