SecReT6
Protein ID: 375261292
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22515
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4846515..4848227 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDG8WIX4, G8WIX4
KEGG IDkox:KOX_22515
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.70E-17, Aligned region: 440..536
Protein Sequence: 570 a.a.     [Download]
>gi|375261292|ref|YP_005020462.1| OmpA/MotB domain-containing protein [Klebsiella oxytoca KCTC 1686]
MSPAQQRGLALWGALLSTVVCLGFLSVTRLVSVLVLLTVLGLIMACWYVASRRARHDVTLQLDNLPEATY
RQPVVLVCGDLPLAWPHQSPVLIVPQGCWIRVEDHQDLEQVARQILWLRPDWGRQLSVMVCVCPQQHPDS
EALTSRLMTLRWRISQLRKETGHSVPLILNGQVGSAMTNDLFWQMALPGEGVRVWRESSVPGSVAAWVTA
GGTPAMQQQVLMNSLMSWFHQHVQAVFMDENPDVPVIAPAAVVWGMRPILAGSLATSAWTAWLSHHTAMQ
QVTGWQPVGTDSTVISPLPDFVLPLLPEGRGLTPHDKAFRCALGIFTLATIAALLSSGWNNRQQLQRVSF
DITRYDRISMDDYGPKADAVAALREDAALLDDHARNGVPARLSLGLYQGGRLRMPVLEAIRSYVPPPLPP
EPQPKPKPVAKIIRLDSMSLFDSGKYNLKPGSTKMLINSLVGVKARPGWLIVVSGHTDNTGNPQLNQTLS
QKRAEAVRDWMRDTGDVPESCFAVQGYGESRPVATNDTPEGRTLNRRVEISLVPQANACQIPGKYPASSQ
DDGASQHNGE
 
Nucleotide Sequence: 1713 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4848227-4846515 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGCCCTGCGCAACAGCGCGGACTTGCGCTGTGGGGCGCCTTGCTAAGTACCGTGGTCTGCCTGGGTT
TTCTGTCGGTCACCCGACTGGTGTCAGTACTCGTTCTGCTTACCGTTCTGGGGCTTATCATGGCGTGCTG
GTATGTCGCCAGTCGCCGCGCGCGGCATGACGTCACCCTGCAACTGGATAACCTACCGGAAGCCACTTAC
CGTCAGCCCGTGGTGCTGGTCTGCGGCGATCTGCCGCTGGCCTGGCCGCATCAATCACCGGTACTCATCG
TCCCGCAGGGATGCTGGATCCGCGTGGAGGATCATCAGGACCTGGAGCAGGTAGCCCGCCAGATACTGTG
GCTGCGCCCGGACTGGGGGCGTCAGCTGTCGGTAATGGTTTGTGTCTGTCCGCAGCAACACCCGGACAGC
GAAGCCCTGACCAGTCGTCTGATGACCCTGCGCTGGCGCATCAGCCAGCTGCGTAAAGAAACGGGTCATT
CTGTGCCACTGATTCTGAATGGTCAGGTCGGCAGCGCGATGACGAATGACCTGTTCTGGCAGATGGCTCT
CCCGGGTGAAGGGGTGAGGGTCTGGCGTGAATCTTCAGTTCCGGGCTCTGTCGCTGCATGGGTCACCGCC
GGCGGAACGCCTGCGATGCAGCAGCAGGTGTTGATGAACAGCCTGATGAGCTGGTTCCATCAGCACGTCC
AGGCTGTTTTTATGGATGAGAACCCCGATGTGCCGGTCATTGCCCCTGCCGCAGTGGTGTGGGGCATGAG
ACCAATCCTTGCCGGAAGCCTGGCCACATCGGCCTGGACGGCGTGGTTGTCCCATCATACCGCGATGCAA
CAGGTGACCGGCTGGCAGCCGGTGGGAACGGACAGTACGGTTATTTCCCCGTTGCCGGATTTTGTCCTGC
CATTGCTGCCGGAAGGGCGAGGCCTGACGCCGCATGACAAAGCCTTCCGCTGTGCGCTCGGGATCTTCAC
GCTGGCGACTATCGCTGCGCTGCTCAGCAGTGGCTGGAACAATCGCCAGCAGCTGCAACGCGTGAGCTTC
GATATTACCCGTTACGACCGCATCTCTATGGATGACTACGGCCCGAAAGCCGACGCCGTTGCGGCCCTGC
GCGAGGATGCGGCATTGCTGGACGACCATGCACGTAACGGTGTACCGGCCCGGCTGAGCCTGGGTTTGTA
TCAGGGCGGGCGTCTGCGCATGCCGGTGCTGGAAGCGATCCGCTCGTATGTGCCGCCGCCACTGCCGCCT
GAACCACAGCCGAAACCCAAACCGGTAGCGAAAATTATCCGCCTCGACAGCATGTCGCTGTTCGACTCGG
GCAAGTACAACCTCAAGCCAGGCTCCACCAAAATGCTGATCAATTCACTGGTGGGCGTTAAGGCCAGACC
GGGCTGGCTGATTGTCGTGTCCGGGCATACCGATAACACCGGCAATCCGCAACTGAACCAGACGCTTTCT
CAGAAACGTGCCGAAGCGGTGCGTGACTGGATGCGTGACACCGGCGACGTGCCGGAAAGCTGTTTTGCGG
TGCAGGGCTATGGCGAAAGCCGTCCTGTCGCAACCAACGACACCCCGGAGGGCCGTACGCTCAACCGCCG
TGTCGAAATCAGTCTGGTACCGCAGGCCAATGCCTGTCAGATACCCGGCAAATACCCGGCGTCATCGCAG
GATGATGGCGCATCACAACACAATGGAGAGTAA