SecReT6
Protein ID: 375261293
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22520
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4848224..4848913 [-]
Productputative OmpA-family membrane protein
NoteTssL
UniProt IDG8WIX5
KEGG IDkox:KOX_22520
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|375261293|ref|YP_005020463.1| putative OmpA-family membrane protein [Klebsiella oxytoca KCTC 1686]
MSERKRGGAASIDIDALLQDTWLQVICLRHGPIFQDGEGRTLWERCIADVERVQRELKASELDEASCQHI
LTAQCALLDEAVKGRGVEDDACVQWYDIPLQGLFLGTMDAGDTLCDRMRDVLREPAPDHAVVTCFQRVMM
LGFLGNFRSLNDPERQKLINALDEYVTPFSYPQTHPVLVESRAGREMGGWLASWPVRIGLSVVVVAALWW
GLDRWLDQMLQTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4848913-4848224 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGTGAGCGTAAACGCGGCGGCGCCGCGTCCATTGATATAGATGCCCTGCTTCAGGATACCTGGCTGC
AGGTGATCTGCCTGCGTCACGGTCCGATATTCCAGGACGGGGAAGGGCGCACGCTTTGGGAACGCTGCAT
TGCTGATGTCGAACGAGTCCAGCGTGAGCTGAAAGCGAGCGAACTTGATGAAGCCAGCTGTCAGCATATT
CTCACGGCACAGTGTGCGTTGCTCGATGAGGCGGTCAAAGGTCGAGGTGTGGAGGACGATGCCTGCGTGC
AGTGGTATGACATTCCCCTGCAGGGGCTCTTCCTTGGCACTATGGACGCGGGTGACACGCTGTGCGATCG
GATGCGTGATGTGCTGCGTGAACCGGCTCCTGACCACGCTGTTGTGACCTGCTTCCAGCGAGTCATGATG
CTGGGTTTCCTCGGCAATTTCCGCTCTCTGAACGACCCTGAACGCCAGAAACTCATTAATGCACTTGATG
AATATGTCACGCCGTTCAGCTATCCACAAACCCATCCAGTCCTGGTGGAAAGCCGCGCCGGACGGGAAAT
GGGCGGCTGGCTGGCATCATGGCCCGTACGTATTGGCCTGAGCGTGGTGGTGGTTGCCGCACTCTGGTGG
GGACTGGATCGCTGGCTGGATCAGATGCTGCAGACCCTGTTGCCGGGAGCGGTGAAATGA