SecReT6
Protein ID: 375261294
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22525
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4848910..4850250 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8WIX6
KEGG IDkox:KOX_22525
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.80E-137, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|375261294|ref|YP_005020464.1| hypothetical protein KOX_22525 [Klebsiella oxytoca KCTC 1686]
MKTEQPLWGRGVMVSPQHFQQQAAYSAWSAECIARLGLSHPWGMIDATFESDALKLGRLQARHLHIRFPD
GTLIDTDNADDLPPVLALENESQHVVVVLALPLLRANGGNCLKPDEVAERPVRYRQRWRDVRNAFGEDTR
QIAVMRPELTLRFAHQNNSDYLTCPIARLQQDSQRAWQLDETFLPPLLAIQGSRWLMTQLEQLMTQLRTR
LSRLMDMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRHPQNPPERLYPELARLAGSLLTFSLE
HQVSAIPVWQHEQLNNVFPPLFDLLGDLLEASLPSRVVAIELEHDARLHFWQARLHDPRLREGADYYLSV
RSRMSAAQLQEQFPRQCKIGSPDHVRSIVNSSRVGVPLAPLRHVPAAIPLRLENQYFSLDVSHPLTTEML
QSGTCMFYVPGMLGEPELEFFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4850250-4848910 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCGTTATGGTCTCTCCCCAGCACTTCCAGCAGCAGGCCG
CGTATTCAGCCTGGTCTGCGGAATGTATCGCCCGACTCGGGCTTTCTCATCCCTGGGGGATGATCGATGC
CACATTCGAATCGGATGCACTGAAACTGGGCCGCCTGCAGGCCCGTCATCTGCATATCCGTTTCCCCGAC
GGGACATTAATCGATACGGATAACGCTGACGATTTGCCACCGGTACTGGCGCTTGAGAATGAATCACAGC
ACGTGGTGGTGGTACTGGCCCTTCCGCTGCTGCGGGCGAACGGCGGCAACTGCCTGAAACCCGATGAGGT
GGCTGAGCGTCCTGTTCGCTATCGGCAGCGCTGGCGGGATGTCCGCAACGCCTTTGGGGAAGATACCCGC
CAGATTGCGGTGATGCGCCCGGAGCTGACGCTGCGTTTCGCCCATCAGAATAACAGCGATTACCTGACCT
GTCCGATCGCCCGCCTGCAGCAGGATTCGCAGAGGGCGTGGCAACTTGATGAGACGTTTCTTCCCCCGCT
CCTGGCCATCCAGGGTAGCCGCTGGCTGATGACCCAACTGGAGCAACTGATGACCCAGTTGCGTACCCGC
CTGAGCCGCCTGATGGATATGCGCAGGGAAAGCAACGAACGGATGGCGGATTTTGCCGTGGCCGATGTGT
CCCTGTTCTGGTTGCTCAATGCTCTGAACAGCGCTGAGCCCGTGCTCGGACAGTTTCAGCGCCATCCGCA
AAACCCACCGGAGCGTCTGTATCCGGAGCTGGCCCGTCTGGCGGGCAGCCTGCTGACCTTCTCGCTGGAG
CACCAGGTGAGTGCGATCCCGGTCTGGCAGCATGAGCAACTGAATAACGTTTTCCCGCCGCTGTTTGATT
TACTGGGTGACCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGGTGGCGATTGAACTTGAGCACGATGCCCG
GCTGCACTTCTGGCAGGCCCGTCTGCATGACCCGCGTCTGCGTGAAGGGGCGGATTACTACCTGTCCGTG
CGTTCGCGGATGTCGGCGGCACAGCTGCAGGAGCAGTTCCCGCGTCAGTGCAAGATCGGCAGTCCCGATC
ATGTCAGAAGTATCGTCAACTCATCGCGGGTGGGCGTACCTCTCGCGCCACTGCGTCATGTACCGGCAGC
CATTCCACTGCGTCTGGAAAACCAGTACTTCAGCCTTGATGTCTCTCACCCCCTGACCACCGAAATGCTC
CAGAGCGGCACATGTATGTTTTACGTTCCGGGAATGCTCGGCGAGCCTGAACTTGAATTCTTTGCGGTAC
TGAGAACATGA