SecReT6
Protein ID: 375261295
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22530
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4850271..4851809 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG8WIX7
KEGG IDkox:KOX_22530
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-172, Aligned region: 87..509
Protein Sequence: 512 a.a.     [Download]
>gi|375261295|ref|YP_005020465.1| type VI secretion protein EvpB [Klebsiella oxytoca KCTC 1686]
MLMSVNTETAPAQGQTAVLEKESVYASLFDKINLTPASRLGDINDFLDDAALSDAPAGERLTAAMQVFMD
CIRQSRKTVEKLDKTLIDHHIAELDYQISRQLDAVMHHPEFQKVESLWRGLKQLVDSTDYRQNVKTEILD
VSKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISGVSAAAHMP
FIGAVGPAFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEQVKGPDHEKYLWTSASFSFASNMVKSFINNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLVQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAV
PHFQVEGMDVNLSLVSQMPKAK
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4851809-4850271 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGCTGATGTCTGTAAATACTGAAACCGCCCCCGCGCAGGGGCAGACCGCTGTACTGGAAAAAGAGAGCG
TTTACGCTTCCCTGTTTGACAAAATCAACCTGACCCCGGCGTCCCGCCTGGGCGATATTAACGACTTTCT
GGATGATGCCGCGCTGTCCGACGCCCCGGCGGGCGAACGACTGACGGCGGCGATGCAGGTGTTTATGGAC
TGCATCCGTCAGTCCAGAAAGACCGTGGAGAAGCTCGACAAGACCCTGATTGACCACCATATCGCGGAGC
TGGACTATCAAATCAGCCGCCAGCTGGACGCGGTGATGCACCATCCTGAGTTCCAGAAGGTGGAATCCCT
GTGGCGCGGCCTGAAGCAGCTGGTGGACAGCACCGACTACCGCCAGAACGTCAAAACCGAAATTCTGGAC
GTCTCCAAAGACGATCTGCGCCAGGACTTCGAAGACGCGCCGGAGCTGATTCAGAGCGGTCTCTACTGGC
ACACCTACACCGCCGAGTACGACACCCCGGGCGGCGAGCCGATTGGCTCGGTGATCTCCGCGTATGAGTT
CGACGCCAGCCCGCAGGACGTGGCGCTGCTGCGCAACATCTCCGGCGTCTCCGCCGCGGCGCATATGCCG
TTTATTGGCGCCGTCGGCCCGGCCTTCTTTCTGAAAGAGTCCATGGAAGAGGTTGCCGCCATCAAGGATA
TCGGCAACTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTTCGCGACACCGACGACGCGCGCTA
TATCGGCCTGGTGATGCCGCGCGTGCTGGGCCGCCTGCCGTATGGACCGGACACCGTGCCGGTGCGCAGC
TTCAACTACGTCGAGCAGGTGAAAGGCCCGGACCATGAGAAATACCTGTGGACCAGCGCCTCGTTCTCCT
TCGCGTCCAATATGGTGAAAAGCTTTATTAATAACGGCTGGTGCGTGCAGATCCGTGGCCCGCAGGCGGG
CGGAGCGGTGAAAGATCTGCCGATCCACCTCTACGATCTGGGCACAGGCAACCAGGTGAAGATCCCGTCG
GAGGTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAGCCTCGGCTTTATCCCGCTGTCGTACTACA
AAAACCGCGACTATGCCTGCTTCTTCTCGGCCAACTCCGCCCAGAAGCCGGCGCTGTACGACACCGCCGA
CGCCACCGCCAACAGCCGCATCAACGCGCGCCTGCCGTATATCTTCCTGCTGTCGCGCATTGCGCACTAC
CTGAAGCTCGTTCAGCGTGAAAACATCGGCACCACCAAGGATCGCCGCCTGCTGGAGCTGGAGCTCAACA
CCTGGGTGCGCGGTCTGGTGACGGAGATGACCGACCCGGGCGACGAGCTGCAGGCCTCGCATCCGCTGCG
CGACGCGAAGGTGGTGGTGGAAGATATCGAGGACAATCCGGGCTTCTTCCGGGTGAAGCTGTACGCGGTG
CCGCACTTCCAGGTGGAAGGGATGGACGTGAACCTGTCTCTGGTTTCTCAGATGCCAAAGGCGAAATAA