SecReT6
Protein ID: 375261968
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_25940
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5598157..5598609 [-]
Producthypothetical protein
NoteTssE
UniProt IDG8WBN7
KEGG IDkox:KOX_25940
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-15, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|375261968|ref|YP_005021138.1| hypothetical protein KOX_25940 [Klebsiella oxytoca KCTC 1686]
MSESPRPSLYETLYGNFTGGIDLYQVSEQNQTIISVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGMP
GTAHELMGALSAVLLKYEPRLKKIDVVLLEQTIPGELRYAIDAELRGIGLVRYGTAFMPEGRVLIRYLKQ
QQYLDAQTHL
 
Nucleotide Sequence: 453 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5598609-5598157 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGTGAGTCACCCCGTCCGTCACTATATGAAACGCTCTACGGCAATTTTACTGGCGGCATTGATCTGT
ATCAGGTCAGCGAGCAGAACCAGACCATCATTTCTGTGCTGGACAATATGCAGCGTATCCTCAACTGCCG
CGCCGGTACGCTGGCGCACCTGCCGGACTACGGTCTGCCGGATATGACTAAAATCCTGCAGGGGATGCCA
GGGACTGCCCATGAACTGATGGGAGCGTTATCGGCTGTACTGCTGAAGTACGAGCCGCGGCTTAAGAAAA
TTGATGTGGTTCTGCTTGAGCAGACTATTCCGGGGGAATTGCGTTATGCCATTGATGCCGAACTCAGGGG
CATCGGTCTGGTGCGTTACGGCACGGCGTTCATGCCTGAAGGGCGCGTGCTGATACGCTACCTTAAACAG
CAGCAGTATCTTGATGCACAGACCCACCTCTAA