SecReT6
Protein ID: 375261969
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_25945
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5598602..5599138 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG8WBN8
KEGG IDkox:KOX_25945
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-38, Aligned region: 19..169
Protein Sequence: 178 a.a.     [Download]
>gi|375261969|ref|YP_005021139.1| hypothetical protein KOX_25945 [Klebsiella oxytoca KCTC 1686]
MAIIAGNFPQIALAAGITLILAGCGLTQKVTDGTVAVTKSIFYKQIKTLHLDIRAREAVNSNAGGVALST
VVRIYQLKDRKTFDTTDYPSLFKADSQAIKADLIAEKDIRLQPGGAVMVDMPMEETAQYVAVAGMFMSPD
QENNTWRVVLSRDDLDPDKARVIEAGNNRLTLQALKDE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5599138-5598602 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGCGATTATCGCTGGTAATTTTCCTCAGATTGCGCTGGCCGCGGGTATCACACTGATACTCGCTGGCT
GTGGGCTGACGCAAAAAGTGACAGACGGCACCGTTGCCGTGACTAAATCAATTTTTTATAAGCAGATAAA
GACCCTGCATCTGGATATTCGCGCCCGCGAGGCCGTCAACAGCAATGCAGGCGGCGTGGCACTGTCGACG
GTGGTACGTATTTACCAGCTCAAGGACCGAAAAACCTTCGACACGACGGACTACCCGTCACTGTTTAAGG
CTGACAGTCAGGCTATTAAAGCAGACCTGATAGCGGAGAAAGATATTCGTCTGCAGCCGGGTGGGGCGGT
GATGGTGGATATGCCGATGGAGGAAACCGCGCAGTATGTTGCGGTGGCTGGCATGTTTATGTCGCCGGAC
CAGGAGAACAACACCTGGCGGGTGGTGCTGAGCCGCGATGACCTCGATCCGGATAAGGCACGCGTCATCG
AAGCGGGCAACAACCGGCTGACCCTGCAGGCGCTGAAAGATGAGTGA