SecReT6
Protein ID: 375261970
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_25950
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5599119..5600177 [-]
Producthypothetical protein
NoteTssG
UniProt IDG8WBN9
KEGG IDkox:KOX_25950
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-81, Aligned region: 10..311
Protein Sequence: 352 a.a.     [Download]
>gi|375261970|ref|YP_005021140.1| hypothetical protein KOX_25950 [Klebsiella oxytoca KCTC 1686]
MERLGDRLPYINFYRFCQLLEQSQPDKPVTGSTWQVRHEPVRFRPHPGMGFPASEIRSFDAAEYPHLPPT
VRITFMGLYGVESPLPTHYIDDITQRREGYEATADFLDIFNHRLIAQYYRIWRKYSYPATFEEGGKDKTS
QYLLGLAGLGIDGCTDSIAAPASRFLALLPVMMLPGRTAEGMASLVRLLAPGTQVKIWHHDKRRVPLKKP
LTMSVSQPVTLTNRPVMGNYATDVNSQVLMRLTTTDPAEVPGWLPGGELHTDLMALLHVYLGSRLDVRLQ
LCVDRCLLPDATMSTKPKAGAVQLGRTAVMRPLNATNTVVHPQIININLGRYERVQENIHRRETDEDGDY
RW
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5600177-5599119 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGAGCGGCTGGGTGACCGGCTGCCATATATCAATTTTTACCGCTTCTGTCAGTTGCTGGAGCAGAGCC
AGCCGGACAAACCGGTTACGGGCAGCACCTGGCAGGTACGTCATGAGCCGGTACGTTTTAGGCCGCACCC
GGGGATGGGCTTCCCGGCTTCAGAAATCAGGTCATTCGACGCTGCTGAGTACCCGCATCTTCCGCCGACG
GTACGTATCACCTTTATGGGGCTTTATGGCGTGGAGTCTCCGCTGCCGACGCACTATATCGATGATATCA
CCCAGCGGCGGGAAGGGTACGAGGCCACGGCGGATTTCCTCGATATCTTCAATCACCGGCTGATTGCCCA
GTACTACCGCATCTGGCGGAAATATTCGTATCCGGCAACTTTTGAGGAAGGCGGTAAGGACAAAACTTCG
CAGTACCTGCTGGGGCTGGCCGGGCTCGGGATTGACGGCTGTACAGACAGTATCGCCGCGCCAGCCTCAC
GCTTTCTGGCGCTGCTGCCGGTCATGATGCTGCCGGGGAGGACTGCAGAAGGCATGGCCTCACTGGTGCG
TCTGCTGGCACCCGGCACGCAGGTAAAAATCTGGCACCACGACAAACGCCGCGTGCCGCTGAAGAAGCCC
CTGACCATGAGCGTCAGCCAGCCCGTCACCCTGACAAACCGTCCGGTGATGGGTAACTATGCCACCGATG
TGAATAGTCAGGTACTGATGCGTCTGACCACCACTGACCCGGCTGAAGTGCCGGGCTGGCTACCGGGCGG
GGAGCTTCACACGGATTTAATGGCTCTGCTGCATGTGTATCTTGGCTCACGGCTCGATGTGCGCCTGCAG
TTATGTGTCGACCGTTGCCTGCTGCCGGATGCGACGATGAGTACTAAACCCAAAGCTGGTGCAGTGCAGC
TGGGCCGCACCGCCGTGATGCGGCCGCTGAATGCGACGAATACCGTCGTACACCCTCAAATTATAAACAT
CAATCTTGGCCGCTATGAGCGGGTCCAGGAAAATATTCACCGCAGGGAGACCGATGAAGATGGCGATTAT
CGCTGGTAA