SecReT6
Protein ID: 375261971
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_25955
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5600177..5601940 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDG8WBP0
KEGG IDkox:KOX_25955
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.80E-183, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|375261971|ref|YP_005021141.1| type VI secretion system protein ImpG [Klebsiella oxytoca KCTC 1686]
MKDQTLRYFDAEMRYLREAAKEFAQTHPDRAAMLDLDKAGTPDPYVERLFEGFAFSMGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSVVALTPALHAMKMAEVVPAGLEVYSRPVGPKNTVCRYRTTQDVMLNPLS
VSAVTMTTEPDGRSLLRMRMACSSQADWSHADLSRLSLYLGADAPVSSQLHLMLTKRQAALYMRLPGQTD
RIRLDGYFSPGGFSEEDGLWPKGDTAFSGYQLLLEYFTFRDKFMFVHFNGLDGITPPAGTEYFDIEVVFS
TPWPSDLPVTDDAVRLHCVPVINLFTLEADPLTITGLESEYLLRPKRLQDGHTEIYSVDSVTGSNRTNDA
EYVPFSSFRHKGGMMRRQAPPRYYHTRVKRSVTGLYDTWLILGGHQWEDDRLLDREAVSLQITGTNGQLP
RRALQSTLLDRCEQVVSTPLSVRNLCKPTLPVYPPAEDRFHWRVLSHLGSGFLNMLSTAEVLRGTLALYN
WQEDELNTRRLEAIQHVEHHRLQRFEQGYLLRGLDIEVTLDSNGFTGEGDIHLFGEMLNRFFALYVDMNQ
FNQLTLIVQPEGKCIRWKENHSPRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5601940-5600177 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAAAGATCAGACCCTGCGCTATTTTGATGCAGAAATGCGCTACCTGCGTGAAGCCGCAAAAGAGTTCG
CGCAAACCCATCCCGATCGTGCAGCGATGCTCGACCTGGATAAAGCTGGTACACCGGATCCGTATGTCGA
ACGCCTGTTTGAAGGCTTTGCTTTCTCGATGGGACGGCTGCGCGAAAAGATTGACGACGACCTGCCGGAA
CTCACCGAAGGGCTGGTCAGTATGCTCTGGCCGCATTACCTGCGTACCATTCCGTCGCTTTCGGTGGTGG
CACTTACCCCAGCGCTGCATGCCATGAAAATGGCCGAAGTCGTGCCCGCGGGGTTGGAGGTGTACTCCCG
CCCGGTGGGGCCGAAGAACACGGTCTGTCGTTACCGTACGACCCAGGATGTAATGCTCAATCCCCTGAGT
GTCTCAGCGGTCACCATGACCACCGAACCTGACGGACGTTCGCTGTTGCGGATGCGCATGGCCTGCAGTA
GTCAGGCGGACTGGTCGCATGCCGACCTCAGCCGCCTGAGCCTCTATCTCGGCGCAGATGCACCCGTCAG
CAGTCAGCTGCACCTGATGCTCACGAAACGACAGGCTGCCCTGTATATGCGTCTGCCCGGGCAGACCGAT
CGTATCCGGCTTGACGGGTACTTCTCGCCGGGAGGATTTTCGGAGGAAGACGGGCTGTGGCCGAAGGGGG
ATACCGCCTTCAGCGGCTACCAGTTGTTGCTGGAGTACTTCACCTTCCGCGACAAGTTTATGTTTGTCCA
CTTTAATGGCCTGGACGGCATCACGCCGCCTGCCGGGACAGAGTACTTCGACATTGAAGTGGTATTCAGC
ACGCCGTGGCCGTCTGATCTGCCGGTCACCGATGACGCGGTTCGACTGCACTGCGTGCCGGTGATTAATC
TGTTCACCCTGGAGGCGGACCCGCTCACCATTACGGGCCTGGAAAGTGAGTACCTGCTGCGCCCCAAACG
GCTGCAGGACGGACACACCGAGATTTACTCCGTGGATTCGGTCACCGGCTCAAACCGGACGAACGACGCG
GAGTATGTGCCGTTCAGCTCCTTCCGCCATAAAGGCGGGATGATGCGCCGCCAGGCACCACCGCGTTACT
ACCATACCCGCGTGAAGCGCAGTGTGACCGGGCTGTATGACACCTGGCTTATCCTCGGCGGTCACCAGTG
GGAAGATGACCGCCTCCTTGACCGCGAAGCCGTGTCGCTACAAATCACCGGCACCAACGGTCAGTTACCA
CGCCGGGCATTGCAGAGCACGCTGCTGGATCGCTGTGAGCAGGTGGTCAGTACACCGCTTTCAGTACGCA
ACCTCTGCAAACCGACGCTGCCGGTCTACCCGCCTGCGGAAGACCGATTCCACTGGCGGGTGCTGAGCCA
CCTGGGCTCCGGATTCCTGAATATGCTGAGTACCGCTGAAGTGCTGCGCGGGACGCTTGCGCTCTATAAC
TGGCAGGAAGATGAACTGAACACCCGGCGTCTGGAGGCTATTCAGCATGTGGAGCATCACCGCCTTCAGC
GCTTTGAGCAGGGCTACCTGCTACGGGGCCTGGATATCGAAGTGACCCTCGACAGCAATGGTTTTACCGG
TGAGGGCGATATTCATCTGTTTGGTGAAATGCTTAACCGGTTTTTTGCGTTGTATGTCGATATGAACCAG
TTCAACCAGCTTACCCTCATCGTTCAGCCAGAAGGAAAATGCATCCGGTGGAAAGAGAATCACAGTCCGC
GCCTGCCAGGCTGA