SecReT6
Protein ID: 375261974
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_25970
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5602947..5603309 [-]
Producthypothetical protein
NoteTssA
UniProt IDG8WBP3
KEGG IDkox:KOX_25970
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-19, Aligned region: 66..119
Protein Sequence: 120 a.a.     [Download]
>gi|375261974|ref|YP_005021144.1| hypothetical protein KOX_25970 [Klebsiella oxytoca KCTC 1686]
MSMLNTLLSACQTEQEPLLVATRERVAQWGSWLQPLSGQSPAGEDPGYDDDFQQMREEVNKLSGADTELI
CRLAEKLLTTTAKDIRVATYYCRAKLHREGEQGLAEGLELLAGLLERFGP
 
Nucleotide Sequence: 363 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5603309-5602947 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGCATGCTGAATACATTACTGAGCGCCTGCCAGACAGAACAGGAACCATTACTTGTAGCAACCCGTG
AGCGAGTGGCGCAGTGGGGCAGCTGGCTGCAGCCGCTGTCCGGGCAATCGCCCGCTGGCGAAGACCCGGG
CTATGACGATGACTTTCAGCAGATGCGCGAGGAGGTCAACAAACTTTCCGGTGCGGATACAGAACTCATC
TGCCGGCTGGCAGAGAAGCTGCTGACCACGACCGCGAAAGACATTCGCGTCGCGACGTACTACTGCCGGG
CGAAGCTGCACCGCGAAGGTGAACAGGGACTGGCTGAAGGACTTGAACTGCTGGCCGGTCTGCTGGAGCG
CTTTGGTCCATAG