SecReT6
Protein ID: 375261981
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_26005
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5611297..5613912 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8WBQ0
KEGG IDkox:KOX_26005
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-58, Aligned region: 35..356
DUF2345 [PF10106], Evalue: 3.40E-46, Aligned region: 609..760
T6SS_Vgr [PF13296], Evalue: 2.60E-31, Aligned region: 488..594
Phage_base_V [PF04717], Evalue: 8.70E-16, Aligned region: 401..481
Sarcoglycan_1 [PF04790], Evalue: 0.0022, Aligned region: 680..729
Sarcoglycan_1 [PF04790], Evalue: 0.0022, Aligned region: 691..742
Protein Sequence: 871 a.a.     [Download]
>gi|375261981|ref|YP_005021151.1| hypothetical protein KOX_26005 [Klebsiella oxytoca KCTC 1686]
MENIFKMTGGVLNRYKLDIPSCPYPLDVERFDGLEQMSALYHYTIRFTSSHPELTAEMMLSKTATLSIGV
GELFNSTVGKIVHGVVTNFRRLIGSRDQVTYEIILEPFISLLDKQFRTHRFFVNKSVPEVVAQILGEHGL
KGWEYEFKLKQTYPKREQINQYQESDLEFIERLLAEVGIFYFFTLQPDTQTEVVHFADKQSAWTFGKKLP
LNSPSGENDNAADSVWGVQVWHNVVERSVTASDYNHREAQSVLMSVPADMTRGDGEGNTYGDVYHYRPRH
LERGDKITPPAETGNFWARLEHERFLSTQTTVTGSSTDHTLGPAQVLTITEMAIPPTLPRETENGVVIIR
TGYYASRKNALKVAWVAIPYYENRCWRPAAKKRPVVSGTLTARVTSAKDNDIYAWQDASGMYRVKFDADR
DDKRQGMESMPVRFAKPYGGDKYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDHVTEANSTRN
VIRTAGLNKLRMEDKRGEEHIKLSTEFGGKTQLNLGHNVDASRELRGEGAELRTDRHVSIRGGAGVFITA
DKQPFAGDKMLSMQEAIAQLENALSIARSMSDAAETAQALPADIQSQVKLTDALKDLVQPGMVLNAPEGV
SITSPQAVRMASGSASVGIMSQQNTDISALKRFTVAAGEAVSMLARKAGMKLFAAKGKVEIQAQDDALDA
IAKKDVTVTSTEGRVEITAAKDVALKNLDGSFIQLQGKNIILGCEGNILWKCANAQKMGSVSMSSVMPQF
PSGYSGKFTASSDAGVPVAAAAYMLTSSNGQKLFGRTDENGETVPVYSSNPNEPFEVEMIQSDYWYDSEN
IVERVHCSSFSDMSFQDDGCQCSDCEGNKSA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5613912-5611297 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGAAAATATATTTAAAATGACAGGGGGGGTCCTTAATCGCTATAAACTAGATATTCCTTCCTGCCCTT
ATCCATTGGATGTGGAACGTTTTGATGGTTTAGAACAAATGAGTGCTCTATATCATTACACCATTCGTTT
TACCAGTTCACATCCGGAGCTTACGGCTGAAATGATGTTAAGTAAAACCGCTACGCTGAGCATAGGGGTG
GGAGAACTATTTAATTCTACTGTCGGTAAAATTGTTCATGGCGTGGTGACAAATTTCCGACGCCTGATCG
GTTCACGCGATCAGGTTACGTATGAAATTATTCTGGAACCCTTTATATCCTTACTGGATAAGCAGTTTCG
TACTCACCGTTTCTTCGTCAACAAATCAGTGCCGGAAGTGGTAGCGCAAATTCTTGGCGAGCATGGTTTG
AAAGGGTGGGAATATGAATTCAAGCTTAAACAAACCTACCCAAAACGGGAACAGATAAACCAGTACCAGG
AAAGTGACCTTGAGTTTATTGAACGCCTGCTGGCAGAGGTGGGGATTTTTTACTTCTTCACCCTGCAGCC
TGACACTCAGACCGAAGTGGTGCACTTCGCGGACAAGCAGAGTGCCTGGACGTTTGGTAAGAAACTGCCG
CTGAACAGCCCGTCAGGGGAGAATGACAATGCGGCCGACTCGGTGTGGGGCGTACAAGTCTGGCATAACG
TGGTGGAGCGTTCGGTCACCGCCAGTGACTACAACCACCGCGAAGCCCAGAGCGTCCTGATGTCCGTACC
GGCTGACATGACCCGCGGCGACGGCGAGGGGAACACCTACGGTGATGTGTACCATTATCGCCCGCGTCAC
CTTGAACGTGGCGACAAAATTACACCGCCGGCAGAAACCGGTAACTTCTGGGCGCGTCTGGAGCATGAAC
GCTTCCTGTCCACCCAGACCACGGTGACCGGCAGCAGCACCGACCACACCCTTGGACCGGCGCAGGTACT
GACTATTACCGAAATGGCTATCCCGCCAACACTGCCCCGTGAAACGGAGAACGGTGTTGTTATTATCCGC
ACTGGCTACTACGCCAGCCGTAAGAATGCCCTAAAAGTGGCATGGGTAGCGATACCCTACTACGAAAACC
GTTGCTGGCGCCCTGCGGCTAAAAAGCGCCCGGTGGTCAGCGGCACCCTGACGGCACGAGTGACCAGCGC
CAAAGATAACGATATCTACGCCTGGCAGGATGCCTCGGGCATGTATCGGGTGAAATTTGATGCTGACCGC
GATGACAAGCGTCAGGGCATGGAAAGTATGCCGGTGCGTTTTGCCAAACCTTACGGCGGAGACAAATACG
GCTTCCACTTCCCGCTGATACAGGGCACGGAAGTTGCTATTGCATTCCACGAAGGCGATCCGGATCGCCC
GTATATAGCTCACGCCCTGCATGACTCCCGTCACGTCGATCACGTCACTGAAGCCAACAGCACGCGCAAT
GTCATCCGTACCGCTGGCCTGAACAAGCTGCGGATGGAGGACAAGCGCGGCGAAGAGCACATCAAGCTCA
GTACAGAGTTCGGGGGCAAGACGCAGCTCAATTTAGGTCACAATGTAGACGCTTCCAGGGAGCTTCGTGG
TGAAGGGGCAGAACTGCGCACCGACCGGCATGTTTCCATTCGCGGTGGTGCTGGTGTGTTTATCACTGCA
GATAAACAACCGTTTGCCGGGGACAAGATGCTTTCCATGCAGGAGGCGATAGCCCAGCTTGAGAATGCAC
TGAGTATTGCCCGCAGCATGTCAGACGCAGCTGAAACCGCGCAGGCGCTACCCGCTGATATTCAGAGTCA
GGTGAAGTTGACTGATGCCCTCAAAGATCTGGTGCAGCCAGGAATGGTGTTGAATGCACCTGAAGGCGTG
AGCATCACCAGCCCACAGGCGGTTCGCATGGCGTCAGGTAGTGCCAGCGTTGGGATCATGTCGCAACAGA
ATACAGACATTAGCGCACTTAAACGATTTACCGTAGCAGCAGGTGAAGCCGTGAGTATGCTGGCCCGAAA
GGCCGGAATGAAACTTTTTGCTGCTAAGGGAAAAGTAGAAATTCAGGCTCAGGATGATGCGCTTGATGCG
ATAGCCAAAAAGGATGTGACCGTAACCAGTACAGAAGGGCGGGTTGAGATCACGGCGGCGAAAGATGTTG
CGCTTAAAAATTTGGATGGGTCGTTCATCCAGTTGCAGGGTAAGAATATTATTCTGGGCTGTGAAGGTAA
TATCCTGTGGAAATGTGCCAATGCGCAGAAAATGGGTAGTGTAAGCATGAGTAGTGTTATGCCCCAGTTT
CCATCTGGATATAGTGGGAAATTTACGGCATCGTCTGATGCAGGAGTTCCAGTTGCCGCTGCGGCATACA
TGTTGACATCGAGTAATGGGCAGAAATTATTTGGTAGAACAGACGAGAACGGTGAAACAGTTCCAGTTTA
CTCATCAAACCCGAATGAGCCTTTTGAAGTTGAAATGATTCAAAGTGATTATTGGTACGATAGTGAAAAT
ATTGTGGAAAGAGTACATTGTTCATCATTTTCAGATATGTCATTCCAGGACGATGGTTGCCAATGCAGTG
ATTGTGAGGGAAATAAAAGTGCGTGA