SecReT6
Protein ID: 375261984
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_26030
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5616455..5616946 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDG8WBQ3, G8WBQ3
KEGG IDkox:KOX_26030
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|375261984|ref|YP_005021154.1| type VI secretion system effector [Klebsiella oxytoca KCTC 1686]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYRAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVSPEMYDIKDPSKEKHNHLERVELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5616946-5616455 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGATCTGTGGACGTTC
AGGATCGCGAGGGCAGCATCGAAGTTGTCGCTCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACCCGTATCCACACGCCGTTCCTGTTCACCAAGGAAATCGACTCGTCCAGCCCG
TATCTGTACAGGGCGGTGACCACCGGTCAGACCCTCAAGTCTGCGGAATTCAAGTGGTACAAGATCAACG
ACGCGGGCCAGGAAGTGGAGTACTTCAACACCAAACTCGAAAACGTGAAGGTGGTGAAAGTGAGCCCTGA
AATGTACGACATCAAGGATCCTTCTAAAGAGAAGCACAACCATCTTGAGCGCGTAGAACTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA