SecReT6
Protein ID: 375261987
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_26045
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5619329..5620666 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8WBQ6
KEGG IDkox:KOX_26045
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.80E-127, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|375261987|ref|YP_005021157.1| hypothetical protein KOX_26045 [Klebsiella oxytoca KCTC 1686]
MKIYRPLWEDGAALAPQQFQQQARWSEYVADMVARMGFSHPLGVVAAEFDDAALALARLNAIRLVVRFQD
GTMVDTDLADNIPPVCDLYAANGSEAVEVVAALPLLSASGGNLDNGQDSERPRRWKAERVVVQELAGHES
GELAILRHALTLRLSSQENTAYLTCPVARLVRNAQGQWSRDPSFIPPMLSVAASPWLATELGDLLVRLQA
RRRRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLTELLQTPDRHPELLYRELSRLAGSLLTFSL
EHDAGDLPAYQHDAPERVFPPLLALLDKLLEASLPSRVVSIHLEHQDQIWKGALHDARLREGADFYLSVR
SSMPNYELQTKFPQLCKAGSFDDVSDVVNVALSGMVIKPLTHVPAAIPLRLENQYFSLDLSSEAARAMLE
AGSCTFYTPRSLGDVKLELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5620666-5619329 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAAAATTTACCGCCCACTTTGGGAGGATGGGGCCGCTCTGGCCCCGCAACAATTCCAGCAGCAGGCCC
GCTGGAGTGAATACGTTGCCGACATGGTCGCCCGGATGGGGTTTTCTCATCCCCTGGGCGTGGTTGCGGC
AGAATTTGATGATGCTGCACTGGCGCTCGCGCGCCTGAATGCCATCCGTCTGGTCGTACGTTTCCAGGAT
GGCACGATGGTTGATACGGATCTGGCGGATAATATTCCGCCGGTCTGTGATTTGTATGCCGCAAACGGCT
CTGAGGCTGTTGAGGTGGTTGCCGCATTGCCGCTGCTGAGCGCCAGTGGTGGCAACCTTGATAACGGACA
AGACAGCGAGCGCCCGCGTCGCTGGAAAGCTGAGCGTGTGGTGGTGCAGGAACTGGCCGGCCATGAAAGC
GGGGAACTCGCGATCTTGCGTCATGCGCTGACCCTGCGTCTGTCCAGCCAGGAAAACACGGCATACCTGA
CCTGTCCGGTCGCTCGTCTGGTGCGTAATGCGCAGGGGCAGTGGAGCCGGGACCCGTCCTTTATCCCGCC
AATGCTGTCTGTTGCTGCCAGTCCGTGGCTTGCCACCGAACTGGGTGACCTGCTGGTCCGTCTGCAGGCC
CGCCGCCGTCGCCTGATGGCCATGCGTCGTGAGAGCAATGAGCGGATGGCAGACTTTGCGGTCGCGGATG
TCTCCCTGTTCTGGCTGCTTAATGCCCTGAACAGCGCCGAGCCGGTGCTGACGGAACTGCTGCAGACACC
GGATCGTCATCCGGAACTGTTGTACCGCGAATTGTCCCGTCTGGCCGGCAGCCTGCTCACCTTCTCTCTG
GAACACGACGCCGGCGATCTTCCTGCTTACCAGCACGATGCACCGGAACGGGTATTTCCGCCGCTGCTGG
CACTGCTCGATAAGCTGCTGGAAGCGAGCCTGCCGTCACGGGTGGTGAGTATCCACCTGGAGCACCAGGA
CCAGATCTGGAAAGGTGCCCTGCACGATGCGCGCCTGCGCGAAGGGGCGGACTTCTACCTTTCCGTACGC
TCCTCCATGCCGAATTATGAACTTCAGACGAAATTCCCGCAGCTGTGTAAAGCGGGCAGCTTTGATGATG
TTTCGGATGTGGTGAATGTGGCCCTGAGCGGGATGGTTATCAAGCCGCTGACCCATGTGCCGGCCGCTAT
CCCGTTACGTCTTGAGAACCAGTATTTCTCGCTGGATCTGAGTAGTGAGGCGGCGCGGGCGATGCTGGAA
GCGGGAAGTTGCACCTTCTATACCCCGCGCTCACTGGGGGATGTGAAACTTGAACTCTTTGCGGTGCTGC
GCACATGA