SecReT6
Protein ID: 375261988
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_26050
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5620685..5622235 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8WBQ7
KEGG IDkox:KOX_26050
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-172, Aligned region: 91..512
Protein Sequence: 516 a.a.     [Download]
>gi|375261988|ref|YP_005021158.1| hypothetical protein KOX_26050 [Klebsiella oxytoca KCTC 1686]
MLMSVNNESQNYTGGATIEKTLPQNGVYASLFNKINLTPVAEIGDLNGFEDNTVMAETSADARVTAAVQV
FMQCLQKSGQKVEKLDKTLLDHHIAELDFQISRQLDKVMHSDEFQKTESVWRGLKSLVDKTDFRQNVKIE
ILDLSKDELRQDFEDSPEIIQSGLYRQTYTMEYDTPGGEPIAAVISAYEFDASAQDVALMRNISKVSAAA
HMPFIGSAGPAFFLKENMEQVAAIKDIGNYFDRAEYIKWKSFRETDDSRYLGLVMPRVLGRLPYGPDTVP
VRSFNYVEEVKGPDHDKYLWTNASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGKQVK
IPSEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGSTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKL
YAIPHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5622235-5620685 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGCTTATGTCAGTCAATAATGAATCCCAGAATTATACAGGCGGTGCGACAATTGAAAAGACGCTGCCAC
AGAATGGTGTTTATGCTTCCCTGTTCAATAAAATTAATTTAACACCGGTTGCTGAAATTGGTGACCTGAA
TGGTTTTGAAGATAATACCGTGATGGCGGAAACATCTGCTGATGCGCGCGTTACTGCCGCCGTTCAGGTC
TTCATGCAGTGCCTACAGAAGTCTGGCCAGAAAGTTGAGAAACTCGATAAAACATTACTGGATCACCACA
TCGCAGAACTGGATTTCCAGATTAGCCGCCAGCTTGATAAAGTGATGCACAGCGATGAATTCCAGAAGAC
AGAATCCGTCTGGCGCGGCCTGAAATCGCTGGTTGATAAGACTGATTTTCGTCAGAACGTAAAAATCGAG
ATTCTTGACCTGTCCAAAGATGAACTGCGTCAGGATTTCGAGGACTCGCCGGAAATTATCCAGAGTGGCC
TGTACCGCCAGACATACACGATGGAATACGACACGCCGGGTGGCGAGCCGATTGCTGCGGTGATTTCAGC
GTACGAGTTTGATGCGTCCGCGCAGGACGTGGCGCTGATGCGCAATATTTCAAAAGTGTCTGCGGCAGCC
CACATGCCGTTCATTGGCTCTGCAGGCCCGGCGTTCTTTTTAAAAGAGAACATGGAGCAGGTTGCCGCTA
TCAAGGACATCGGTAATTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTCCGCGAGACGGACGA
TTCCCGCTATCTCGGTCTGGTGATGCCGCGCGTGCTGGGACGCCTGCCGTATGGCCCGGATACCGTACCG
GTGCGCAGTTTCAACTACGTTGAAGAAGTGAAAGGCCCGGATCACGATAAATACCTGTGGACCAACGCCT
CGTTCGCCTTTGCGGCCAACATGGTGAAGAGCTTCATCAACAACGGCTGGTGCGTGCAAATCCGTGGCCC
GCAGGCCGGTGGTGCCGTCCAGGACCTGCCAATCCATCTGTATGACCTCGGCACCGGCAAACAGGTGAAG
ATTCCGTCAGAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAGCCTCGGCTTCATTCCCCTGT
CGTACTACAAGAACCGCGACTATGCGTGCTTCTTCTCGGCGAACTCCACCCAGAAACCGGCGCTGTACGA
CACCGCCGATGCGACGGCCAACAGCCGCATTAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATC
GCCCACTATCTGAAGCTGATTCAGCGCGAGAACATCGGTTCCACCAAGGACCGCCGCCTGCTGGAGCTGG
AACTCAACACCTGGGTGCGCAGTCTGGTGACCGAAATGACCGATCCGGGCGACGAGCTGCAGGCCTCACA
CCCACTGCGCGACGCAAAAGTGGTGGTGGAAGACATCGAAGACAATCCGGGCTTCTTCCGCGTGAAGCTG
TACGCTATCCCGCACTTCCAGGTGGAAGGCATGGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAAG
CCAAATCGTAA