SecReT6
Protein ID: 375261989
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_26055
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5622272..5622769 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDG8WBQ8
KEGG IDkox:KOX_26055
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-51, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|375261989|ref|YP_005021159.1| type VI secretion protein [Klebsiella oxytoca KCTC 1686]
MSESFQNEIPRARVNIKLDLVTGGARKKVELPLKLLTVGDYSNGRAEGTLSEREKININKNNFNSVLADL
HPEVNITVKNTLANDGSEENVKLLFQNMKDFEPEAVARQIPQLRAMLAMRNLLRDLKSNLLDNVTFRKEL
ETILKDPALTDELRRELNALAPVQG
 
Nucleotide Sequence: 498 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5622769-5622272 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGTCTGAATCATTTCAGAACGAGATACCCCGCGCGCGCGTAAATATAAAACTGGATCTGGTCACGGGCG
GTGCCAGGAAGAAAGTTGAACTGCCGCTGAAGCTGCTGACTGTCGGCGATTACAGCAATGGCAGGGCGGA
GGGGACCCTTTCAGAGCGCGAAAAAATCAACATCAATAAAAATAACTTCAACAGCGTTCTCGCTGATCTC
CATCCCGAAGTAAATATCACCGTTAAAAATACCCTGGCAAACGATGGCTCCGAAGAAAACGTGAAGCTGC
TTTTTCAGAATATGAAGGATTTTGAGCCAGAGGCGGTGGCACGTCAAATACCTCAGCTCCGTGCGATGCT
CGCTATGCGTAATTTACTGCGTGATTTGAAATCCAATCTTCTGGATAATGTCACTTTCAGGAAAGAACTG
GAAACTATTTTAAAGGACCCGGCACTTACTGATGAACTTCGCCGCGAACTGAATGCGCTTGCCCCGGTAC
AGGGATAA