SecReT6
Protein ID: 37526200
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2287
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2684731..2687313 [-]
Producthypothetical protein
NoteTssH
UniProt IDQ7N4N8
KEGG IDplu:plu2287
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.50E-42, Aligned region: 212..290
AAA_2 [PF07724], Evalue: 4.50E-42, Aligned region: 578..751
AAA [PF00004], Evalue: 1.10E-21, Aligned region: 214..326
AAA [PF00004], Evalue: 1.10E-21, Aligned region: 583..705
AAA_5 [PF07728], Evalue: 6.80E-14, Aligned region: 214..292
AAA_5 [PF07728], Evalue: 6.80E-14, Aligned region: 582..703
AAA_16 [PF13191], Evalue: 1.60E-13, Aligned region: 4..86
AAA_16 [PF13191], Evalue: 1.60E-13, Aligned region: 191..236
AAA_16 [PF13191], Evalue: 1.60E-13, Aligned region: 258..293
AAA_16 [PF13191], Evalue: 1.60E-13, Aligned region: 422..475
AAA_16 [PF13191], Evalue: 1.60E-13, Aligned region: 576..623
AAA_16 [PF13191], Evalue: 1.60E-13, Aligned region: 648..671
ClpB_D2-small [PF10431], Evalue: 8.40E-12, Aligned region: 759..830
IstB_IS21 [PF01695], Evalue: 2.20E-08, Aligned region: 194..245
IstB_IS21 [PF01695], Evalue: 2.20E-08, Aligned region: 563..604
AAA_22 [PF13401], Evalue: 3.30E-08, Aligned region: 153..209
AAA_22 [PF13401], Evalue: 3.30E-08, Aligned region: 214..308
AAA_22 [PF13401], Evalue: 3.30E-08, Aligned region: 438..489
AAA_22 [PF13401], Evalue: 3.30E-08, Aligned region: 580..619
Arch_ATPase [PF01637], Evalue: 3.80E-08, Aligned region: 193..235
Arch_ATPase [PF01637], Evalue: 3.80E-08, Aligned region: 265..363
Arch_ATPase [PF01637], Evalue: 3.80E-08, Aligned region: 581..622
Arch_ATPase [PF01637], Evalue: 3.80E-08, Aligned region: 653..677
Sigma54_activat [PF00158], Evalue: 8.60E-08, Aligned region: 208..232
Sigma54_activat [PF00158], Evalue: 8.60E-08, Aligned region: 580..702
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 209..238
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 267..310
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 390..468
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 577..609
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 725..796
AAA_14 [PF13173], Evalue: 5.10E-07, Aligned region: 214..348
AAA_14 [PF13173], Evalue: 5.10E-07, Aligned region: 581..677
AAA_19 [PF13245], Evalue: 1.70E-06, Aligned region: 212..235
AAA_19 [PF13245], Evalue: 1.70E-06, Aligned region: 578..604
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 214..261
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 481..517
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 582..617
NACHT [PF05729], Evalue: 3.40E-05, Aligned region: 214..250
NACHT [PF05729], Evalue: 3.40E-05, Aligned region: 583..607
AAA_18 [PF13238], Evalue: 3.40E-05, Aligned region: 214..247
AAA_18 [PF13238], Evalue: 3.40E-05, Aligned region: 584..609
TIP49 [PF06068], Evalue: 6.00E-05, Aligned region: 214..253
TIP49 [PF06068], Evalue: 6.00E-05, Aligned region: 262..294
TIP49 [PF06068], Evalue: 6.00E-05, Aligned region: 581..617
AAA_29 [PF13555], Evalue: 7.30E-05, Aligned region: 206..230
AAA_29 [PF13555], Evalue: 7.30E-05, Aligned region: 576..600
T2SE [PF00437], Evalue: 0.00012, Aligned region: 193..236
T2SE [PF00437], Evalue: 0.00012, Aligned region: 570..620
Zeta_toxin [PF06414], Evalue: 0.0003, Aligned region: 214..234
Zeta_toxin [PF06414], Evalue: 0.0003, Aligned region: 581..632
Clp_N [PF02861], Evalue: 0.00036, Aligned region: 23..46
Clp_N [PF02861], Evalue: 0.00036, Aligned region: 107..124
AAA_11 [PF13086], Evalue: 0.00044, Aligned region: 213..480
AAA_11 [PF13086], Evalue: 0.00044, Aligned region: 572..725
RNA_helicase [PF00910], Evalue: 0.00075, Aligned region: 215..235
RNA_helicase [PF00910], Evalue: 0.00075, Aligned region: 583..604
UPF0079 [PF02367], Evalue: 0.00083, Aligned region: 214..234
UPF0079 [PF02367], Evalue: 0.00083, Aligned region: 571..605
DUF258 [PF03193], Evalue: 0.0013, Aligned region: 209..233
DUF258 [PF03193], Evalue: 0.0013, Aligned region: 572..596
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 207..289
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 582..619
SRP54 [PF00448], Evalue: 0.0024, Aligned region: 213..245
SRP54 [PF00448], Evalue: 0.0024, Aligned region: 581..604
Hpr_kinase_C [PF07475], Evalue: 0.0039, Aligned region: 214..226
Hpr_kinase_C [PF07475], Evalue: 0.0039, Aligned region: 579..601
NTPase_1 [PF03266], Evalue: 0.0073, Aligned region: 214..236
NTPase_1 [PF03266], Evalue: 0.0073, Aligned region: 582..603
MobB [PF03205], Evalue: 0.0081, Aligned region: 215..238
MobB [PF03205], Evalue: 0.0081, Aligned region: 581..613
DUF2075 [PF09848], Evalue: 0.0088, Aligned region: 214..316
DUF2075 [PF09848], Evalue: 0.0088, Aligned region: 581..613
Protein Sequence: 860 a.a.     [Download]
>gi|37526200|ref|NP_929544.1| hypothetical protein plu2287 [Photorhabdus luminescens subsp. laumondii TTO1]
MSNYLKQIVSKLTVEARQCLDEAVNLAVRRTHHEVEIEHLLLALFEKQLPTMEQVCHHGGIDSMTLLNAC
QRSLALLRSGNHRPPVLATNLTEWMEQTWMYASTHWGASQITAQVLIVALIMNPSLHHSLTSELQQALQG
NTDGIEPWLRTQTNTTPQHITAPVGDNTQSALAQYTHHLTQAARDNKLDPVLGREREIRQLIDVLLRRRQ
NNPLLTGEAGVGKTALIEGLAQRIVDGRVPKVLAQAELFTLDMGLLQAGASVKGEFESRLQKLLDEVKKY
PTPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRAIAATTWSEYKKYFEKDAALARRFQLIKVE
EPSLELAIAMLRAITPAMEKHHNVKVLAEAVTEAVTLANRYITGRQLPDKSVSLLDSACARVAVSQTDEP
APIEDLRAMLANIAAEQEALLREGGHETQLQKLAQRQAKLQASLAEILPEYHAQRQLVNDILACDEHDER
LPVLRAELHQRHHQHAYVFDCVDAACVADIVAGWTGIPLGRMVENERDVLRQLETRLGQRVMGQDHALSQ
IARQIRIAKVQLADPIKPTGVFMLAGPSGVGKTETALALAHELYGGEHHLITINMSEYQEAHSVSGLKGS
PPGYVGYGQGGVLTEAVRRQPYSVVLLDEVEKAHPDVLELFFQVFDKGMMEDAEGQQINFRNTLIILTTN
AASDLVMRAAMHGVKEQGENRPATLEDIQEIIRPELQRIFTPAFLGRLQVIPYLPVQGEVLHAIVHHKLN
KIVTRYRQSTQCELHYSDTLVDFIAKGCQIAESGAREIDNLLTQFVLPLLSDQLLLGGVPVNQDVWMDVI
DGQIQLRSDQKKLSLSNIIN
 
Nucleotide Sequence: 2583 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2687313-2684731 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGAGTAATTATCTTAAACAGATCGTCAGTAAATTAACGGTAGAAGCGCGTCAGTGCCTTGACGAGGCGG
TTAATCTGGCAGTACGGCGCACCCATCATGAAGTGGAAATTGAACATTTGCTGTTGGCTTTGTTTGAAAA
ACAGCTTCCGACGATGGAGCAAGTGTGTCACCACGGCGGTATTGATAGCATGACATTGTTGAATGCTTGC
CAACGGTCACTGGCATTATTACGCAGCGGTAATCATCGTCCGCCGGTGCTGGCTACCAACTTAACTGAAT
GGATGGAACAGACCTGGATGTACGCCAGTACTCACTGGGGAGCATCACAGATTACCGCTCAAGTACTGAT
TGTGGCCCTGATCATGAATCCGTCACTGCACCATTCTCTTACCTCAGAGCTACAACAAGCGTTACAGGGT
AACACCGATGGGATAGAACCGTGGTTGCGTACACAGACAAATACGACACCACAACACATTACAGCACCTG
TTGGGGATAATACCCAATCCGCACTGGCACAATACACGCATCACCTGACACAAGCAGCGCGTGATAACAA
ACTCGATCCGGTTTTAGGACGTGAACGAGAGATTCGTCAGTTGATTGACGTGCTATTACGTCGTCGCCAA
AACAACCCGCTGTTAACCGGTGAAGCCGGTGTCGGCAAAACCGCGCTGATTGAAGGGCTTGCTCAGCGGA
TCGTGGATGGCCGTGTACCGAAAGTTTTGGCACAAGCCGAACTATTTACGCTGGATATGGGGCTGTTACA
AGCGGGTGCCAGCGTAAAAGGTGAGTTTGAAAGCCGCTTGCAAAAATTATTGGATGAGGTGAAGAAGTAT
CCCACCCCGGTGATTCTGTTTATCGATGAAGCGCATACGCTGATTGGCGCAGGTGGTCAAGCCGGACAAA
ATGATGCGGCTAATCTGTTGAAACCCGCGCTGGCACGTGGCGAATTACGGGCAATTGCGGCAACCACCTG
GTCTGAATATAAGAAGTATTTTGAAAAAGACGCCGCGTTAGCACGTCGTTTCCAGTTGATCAAAGTCGAA
GAACCTTCGCTAGAACTGGCAATCGCCATGTTGCGGGCCATAACACCCGCAATGGAAAAGCATCATAACG
TCAAAGTACTTGCAGAGGCAGTCACGGAAGCGGTTACGTTAGCCAACCGTTATATCACTGGACGTCAGTT
ACCGGATAAATCAGTTAGCCTGTTAGATAGCGCCTGTGCCCGCGTTGCCGTTTCACAGACCGATGAACCG
GCACCGATTGAAGATCTGCGAGCCATGTTGGCAAACATTGCTGCCGAACAGGAAGCCCTGTTACGTGAAG
GCGGCCATGAAACTCAGTTACAGAAATTGGCGCAGCGTCAGGCTAAATTGCAGGCATCACTGGCAGAAAT
TTTGCCGGAATATCACGCTCAACGTCAGTTGGTCAATGACATCCTCGCCTGTGACGAACACGACGAACGG
CTACCAGTGTTACGTGCAGAACTGCATCAGCGCCACCATCAGCACGCTTATGTCTTTGACTGTGTTGATG
CCGCCTGTGTAGCAGACATTGTTGCTGGTTGGACAGGGATACCCCTTGGTCGAATGGTCGAAAATGAGCG
TGATGTGTTGCGTCAGTTGGAAACCCGTCTCGGCCAACGGGTTATGGGGCAAGATCATGCGCTCAGCCAG
ATAGCACGTCAAATTCGGATTGCTAAAGTACAACTTGCCGATCCAATCAAACCTACCGGAGTATTTATGC
TCGCAGGGCCTTCCGGTGTAGGAAAAACCGAGACCGCCTTAGCGCTGGCTCATGAGTTGTATGGTGGTGA
ACATCATCTGATCACAATTAACATGTCGGAATATCAGGAAGCTCATTCGGTTTCCGGCCTGAAAGGTTCT
CCTCCAGGCTACGTCGGTTATGGACAAGGTGGTGTATTGACCGAAGCAGTTCGACGTCAACCTTACAGCG
TCGTGCTACTTGATGAAGTGGAGAAAGCTCACCCCGATGTGCTGGAACTGTTCTTTCAGGTGTTCGATAA
AGGCATGATGGAAGATGCCGAAGGGCAACAGATTAACTTTCGCAATACGCTAATTATCCTGACCACAAAT
GCGGCATCAGATTTGGTAATGCGGGCCGCCATGCACGGCGTAAAAGAGCAGGGGGAAAATCGCCCGGCCA
CCCTGGAAGATATTCAGGAGATTATCCGACCAGAGCTACAACGTATTTTTACGCCCGCATTTTTAGGTCG
TTTGCAGGTTATTCCTTATCTTCCGGTACAGGGCGAAGTTCTGCATGCCATTGTGCACCATAAACTGAAT
AAAATTGTCACACGTTATCGTCAATCAACCCAATGTGAATTGCACTATAGCGACACGCTGGTGGATTTTA
TCGCTAAAGGATGCCAGATCGCGGAAAGCGGTGCTCGTGAAATTGATAATCTGTTAACCCAGTTTGTCCT
GCCGTTGTTATCAGATCAATTGCTATTAGGTGGCGTGCCAGTCAATCAGGATGTCTGGATGGATGTTATA
GACGGTCAAATACAGCTACGATCAGACCAAAAGAAACTATCACTATCTAATATTATCAACTAA