SecReT6
Protein ID: 37526203
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2290
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2691451..2692848 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7N4N5
KEGG IDplu:plu2290
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-98, Aligned region: 19..463
Protein Sequence: 465 a.a.     [Download]
>gi|37526203|ref|NP_929547.1| hypothetical protein plu2290 [Photorhabdus luminescens subsp. laumondii TTO1]
MFEHKPMYWYSGLYLQPQHFQAHELQHEYWQGRYQLLTQPYAFGVVKLAFNLAALSDEVLSVHHAAFIFP
DGGYVDCDVNGVLSARSLRDCWPVRDKPQRIYVGLRMFSHNQNNVTGITDANGVGNITSRWVTWPQEQRM
RDAFGEGPEAEVQQLTYNLRFFLHDEIAQATGYTLLPVGQLHCTSDGIALDNRYLPPCLTLYAVPQLGQR
IDQLCQELTGRIHQLEELKRPQTLEGEIYTQEKSTLLLTLRTLARYVVQLHHFQEARDVHPLQIFGLLRQ
LISELSCFTDRCSFLGQWNGQEEVLEKYQHLDLALTLDSCERTIADLLNALVLEPNTVISLQQESRGYYH
ATFNTTGSNEQQRLYLVLRSDSFTHREREIPDDRLIKLAAAEQIDNIINRALPGVRLYYQEIAPHGLPNR
ANTCYFRLENRGALWQQVEESKRVAVHWADAPDDLQTEIVIVRAS
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2692848-2691451 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTTTGAACATAAACCGATGTATTGGTATTCAGGATTATATTTACAGCCGCAACACTTTCAGGCCCATG
AATTGCAACATGAATACTGGCAAGGACGTTATCAGTTACTGACACAACCTTATGCTTTTGGTGTGGTGAA
ACTCGCATTCAATCTGGCCGCGCTAAGTGATGAAGTACTGAGTGTCCATCACGCCGCGTTTATTTTTCCC
GATGGTGGTTACGTGGATTGTGATGTCAACGGCGTACTCAGTGCCCGATCATTGCGGGATTGCTGGCCGG
TACGTGACAAACCGCAGCGCATCTATGTTGGCCTGCGCATGTTCAGCCACAATCAGAATAACGTCACCGG
TATCACGGATGCCAATGGTGTCGGTAATATCACCAGCCGGTGGGTAACATGGCCGCAAGAACAGCGTATG
CGGGATGCTTTTGGCGAGGGGCCGGAAGCGGAAGTGCAACAATTGACCTATAACTTACGTTTTTTCTTGC
ACGATGAGATTGCTCAGGCAACGGGTTATACACTATTACCGGTTGGCCAACTGCACTGCACCAGTGACGG
TATTGCGCTGGATAACCGCTATCTACCGCCATGTTTGACGCTCTATGCTGTGCCACAACTGGGCCAGCGC
ATTGATCAACTGTGTCAGGAGTTAACCGGGCGTATCCATCAATTGGAAGAGTTGAAACGCCCGCAAACAC
TGGAAGGGGAAATTTATACTCAGGAAAAAAGCACATTATTGCTGACACTACGGACTCTGGCGCGTTATGT
CGTACAGTTGCACCATTTTCAGGAAGCGAGAGATGTTCACCCCTTACAGATTTTTGGATTATTGCGCCAA
CTGATCAGCGAGCTTTCCTGTTTTACCGACCGTTGCTCCTTTTTAGGCCAGTGGAACGGGCAGGAAGAGG
TACTGGAGAAATATCAGCATCTGGATCTGGCGCTAACTCTTGATAGTTGTGAACGGACAATTGCCGATTT
GCTTAATGCGCTGGTGCTGGAACCCAATACCGTGATCTCTCTGCAACAGGAAAGCCGTGGTTATTATCAT
GCAACCTTCAATACAACGGGGAGCAATGAACAGCAACGGCTCTATTTGGTGCTGCGTTCTGACAGCTTTA
CTCATCGCGAGCGTGAAATTCCTGATGATCGCTTGATTAAACTGGCGGCGGCAGAACAGATCGACAACAT
TATTAACCGTGCTTTGCCCGGTGTACGTCTGTACTACCAGGAAATTGCGCCACATGGTTTACCTAACCGA
GCAAACACCTGCTATTTCCGGCTAGAAAATCGCGGTGCATTATGGCAGCAGGTAGAAGAGAGCAAACGTG
TGGCAGTGCACTGGGCAGATGCGCCAGACGATTTACAAACAGAAATCGTTATAGTGAGAGCGTCATGA