SecReT6
Protein ID: 37526204
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2291
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2692852..2693529 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ7N4N4
KEGG IDplu:plu2291
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.40E-22, Aligned region: 20..159
Protein Sequence: 225 a.a.     [Download]
>gi|37526204|ref|NP_929548.1| hypothetical protein plu2291 [Photorhabdus luminescens subsp. laumondii TTO1]
MNNINFYSIIKRRFLILTVILLISGCSHSISNDEKRLQAIEQAKPVYASNAIRLKITAVPQLNVFNNIPN
SCTILIVQAEKREQLDKLLANPALLRNLFSGTGATEHILQLDNYVMMPGQSVSLHIDRAEQARYIALIAG
YYPAPESTHTRVLSLPLRLEQHGWWNSAWSAEFVPMRINLTLGRYAITRSDFSAGNTGDEVVFPEQIVFP
GQTAESGSDESVLRK
 
Nucleotide Sequence: 678 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2693529-2692852 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAATAACATAAATTTTTATAGCATCATTAAACGCCGTTTTTTAATATTGACAGTAATTCTTTTAATAA
GTGGTTGCAGTCATTCTATCTCCAACGATGAAAAACGTTTGCAGGCAATCGAACAAGCCAAACCGGTTTA
TGCCAGCAATGCCATTCGTTTAAAAATAACCGCGGTTCCGCAACTGAATGTTTTTAATAATATACCAAAC
AGTTGCACAATATTAATTGTTCAAGCGGAGAAACGTGAACAATTAGATAAATTACTGGCTAATCCGGCGT
TATTACGCAATTTATTTTCCGGCACCGGTGCAACAGAACACATATTACAGTTGGATAATTACGTGATGAT
GCCGGGGCAATCAGTATCTTTACACATCGATAGAGCGGAACAGGCGCGTTATATCGCATTAATTGCCGGT
TACTACCCGGCACCAGAGAGTACTCATACGCGAGTATTATCACTGCCGCTGCGCCTTGAGCAACACGGTT
GGTGGAATAGCGCCTGGAGTGCTGAATTTGTTCCCATGCGTATTAATCTGACGCTAGGACGTTACGCCAT
TACCCGCAGTGATTTCTCAGCAGGTAACACTGGCGATGAGGTAGTTTTCCCCGAACAAATCGTTTTCCCC
GGACAAACGGCGGAATCCGGCAGTGACGAAAGTGTGTTGAGGAAGTAA